SecReT6
Protein ID: 153947604
SecReT6 ID220
T6SS typei1
Gene symbol-
Locus tagYpsIP31758_0318
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]368434..369750 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDA7FDI4
KEGG IDypi:YpsIP31758_0318
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 0.0047, Aligned region: 34..100
FHA [PF00498], Evalue: 0.0047, Aligned region: 224..239
Protein Sequence: 438 a.a.     [Download]
>gi|153947604|ref|YP_001399312.1| FHA domain-containing protein [Yersinia pseudotuberculosis IP 31758]
MDKKQPTLSLRVVNSDKLESGKQASSLFHAQGGSVGSDGSHHWSIQDQGGNISPSQFAIEWRDGSFCLRM
LNGSLNINHSMLTPNSGFVRLQQGDEMTLGNLVIKSHISRSAADMIDPLMVSPESLVSSYSNPMDAMMEG
EPLASPHHQQDSRLAATVSHNFSHDPLRVLETESLTTQGHDAVISDADHSLQQDRYRNPLFSSPLSDTPK
DSAMDQAFIDLPQISTFLNGKQAGGKPEGLNNQMEQHHVAITPLMRGFDAQLPIRNSQEAHDFLEEAGKT
LKATIEGLLALQRSQHGLRDKHLRPIEDNPLRLNMDYDTTLNLMFADQKSPVHLSAPAAVAESLDNLRLH
HQANQQAITQALNTMLEAFSPERLLTRFTHYLRSNERQEQDSAWAWDMYKNYYNELASSRQQGFEKLFGE
VYEQAYDRALRQGMKDSE
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|153946813|ref|NC_009708.1|:368434-369750 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGGATAAAAAACAACCAACGCTGTCATTGCGGGTCGTCAACAGCGATAAATTAGAGAGTGGCAAACAAG
CCAGCAGCCTGTTTCATGCGCAAGGGGGCAGTGTCGGCAGTGACGGTAGCCATCATTGGTCGATTCAGGA
CCAAGGCGGCAATATCAGCCCGTCACAGTTTGCTATCGAATGGCGTGATGGCTCTTTCTGCCTGCGGATG
CTGAATGGCTCTCTGAACATTAATCATTCGATGCTAACACCCAATTCGGGTTTCGTTCGCCTACAGCAAG
GGGATGAAATGACGTTGGGTAATCTGGTGATCAAAAGCCATATCAGCCGTTCTGCTGCCGATATGATCGA
TCCACTGATGGTGTCACCAGAGTCACTGGTATCGAGTTACAGCAACCCGATGGATGCCATGATGGAGGGG
GAGCCGTTGGCCTCGCCTCATCATCAGCAAGACAGCCGGTTAGCCGCGACGGTTAGCCATAATTTCAGCC
ATGATCCATTACGGGTATTGGAAACGGAAAGCCTGACCACGCAAGGCCATGACGCCGTGATATCTGATGC
TGATCACTCTCTACAGCAGGACCGATACCGTAACCCACTTTTCTCTTCCCCGCTCTCTGATACCCCCAAG
GACAGTGCTATGGATCAGGCGTTTATCGATCTCCCGCAGATCAGTACCTTTCTTAACGGTAAACAAGCGG
GGGGCAAACCAGAAGGACTCAATAACCAAATGGAACAACATCACGTTGCCATTACGCCGCTGATGCGTGG
TTTTGACGCTCAACTCCCGATCCGCAACAGCCAGGAAGCTCACGATTTCCTTGAAGAGGCGGGTAAAACA
CTCAAAGCGACAATCGAAGGTCTGCTCGCCTTACAACGCAGTCAGCATGGCTTGCGTGATAAGCACTTAC
GGCCGATTGAAGATAATCCATTGCGTCTGAATATGGATTACGACACCACCCTCAACTTGATGTTTGCCGA
TCAAAAAAGCCCGGTTCATCTTTCAGCGCCCGCCGCCGTGGCCGAAAGCCTGGATAACCTGCGTTTGCAT
CATCAGGCCAATCAACAGGCGATTACGCAAGCCTTGAACACCATGTTGGAAGCCTTCTCCCCTGAGCGTT
TACTGACGCGTTTTACCCATTATTTGCGCAGTAATGAGCGGCAAGAGCAGGACTCCGCCTGGGCGTGGGA
TATGTACAAAAACTACTATAACGAGCTGGCCTCCAGCCGCCAGCAAGGTTTTGAAAAACTGTTTGGCGAA
GTGTATGAGCAAGCCTATGACCGGGCCTTACGTCAAGGCATGAAGGATAGCGAGTAA