SecReT6
Protein ID: 153947727
SecReT6 ID223
T6SS typei3
Gene symbol-
Locus tagYpsIP31758_1370
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]1606163..1606702 [+]
Productlipoprotein
NoteTssJ
UniProt IDA7FGH1
KEGG IDypi:YpsIP31758_1370
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.50E-36, Aligned region: 22..172
Protein Sequence: 179 a.a.     [Download]
>gi|153947727|ref|YP_001400349.1| lipoprotein [Yersinia pseudotuberculosis IP 31758]
MNKSIRGVYRATQYLFLVLVTLLTIACSSKVQPEKAEKLTVEIATAADINPNDKGVANPLRIALYTLKST
DEFQSSDFFTITEENTPSLKEQMDNVFDRIMLPSETKKIELTLDAGVTAIGIVAAYREIEQAEWKAVIYP
LPKKRVDPWYKKMWPGQDQQDPIMKVRVERLSISIKEMD
 
Nucleotide Sequence: 540 bp     [Download]
>gi|153946813|ref|NC_009708.1|:1606163-1606702 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGAATAAAAGTATCCGAGGGGTTTACCGGGCGACACAGTACTTATTTTTGGTACTGGTAACGTTATTGA
CGATAGCCTGTAGTTCAAAAGTGCAACCTGAAAAGGCTGAAAAACTTACCGTCGAAATCGCGACAGCAGC
GGATATTAATCCGAATGATAAAGGGGTGGCGAACCCGCTAAGGATTGCGCTTTATACACTCAAGAGCACC
GATGAATTTCAGTCGAGTGATTTCTTCACTATCACTGAAGAAAATACGCCATCGCTAAAAGAACAAATGG
ATAACGTGTTTGACCGGATTATGTTGCCAAGCGAGACCAAAAAAATAGAGCTGACACTTGATGCTGGCGT
TACTGCTATCGGCATCGTGGCTGCTTATCGTGAAATTGAACAGGCGGAGTGGAAAGCGGTTATTTATCCG
TTGCCCAAAAAGCGCGTGGACCCTTGGTATAAAAAAATGTGGCCAGGGCAAGACCAACAAGATCCGATCA
TGAAGGTACGCGTTGAGCGTCTGTCAATATCAATTAAAGAAATGGATTAA