SecReT6
Protein ID: 153947751
SecReT6 ID221
T6SS typei2
Gene symbolclpV1
Locus tagYpsIP31758_0732
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]894308..896956 [+]
Producttype VI secretion ATPase
NoteTssH
UniProt IDA7FEP3
KEGG IDypi:YpsIP31758_0732
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.40E-41, Aligned region: 237..257
AAA_2 [PF07724], Evalue: 2.40E-41, Aligned region: 611..775
AAA [PF00004], Evalue: 1.30E-19, Aligned region: 239..351
AAA [PF00004], Evalue: 1.30E-19, Aligned region: 616..734
AAA_5 [PF07728], Evalue: 1.40E-14, Aligned region: 239..263
AAA_5 [PF07728], Evalue: 1.40E-14, Aligned region: 615..734
ClpB_D2-small [PF10431], Evalue: 8.30E-14, Aligned region: 782..860
AAA_16 [PF13191], Evalue: 7.80E-13, Aligned region: 134..197
AAA_16 [PF13191], Evalue: 7.80E-13, Aligned region: 216..261
AAA_16 [PF13191], Evalue: 7.80E-13, Aligned region: 284..317
AAA_16 [PF13191], Evalue: 7.80E-13, Aligned region: 471..532
AAA_16 [PF13191], Evalue: 7.80E-13, Aligned region: 584..659
AAA_16 [PF13191], Evalue: 7.80E-13, Aligned region: 680..710
AAA_16 [PF13191], Evalue: 7.80E-13, Aligned region: 753..806
AAA_25 [PF13481], Evalue: 1.70E-08, Aligned region: 239..312
AAA_25 [PF13481], Evalue: 1.70E-08, Aligned region: 613..647
AAA_22 [PF13401], Evalue: 1.80E-08, Aligned region: 62..110
AAA_22 [PF13401], Evalue: 1.80E-08, Aligned region: 238..324
AAA_22 [PF13401], Evalue: 1.80E-08, Aligned region: 614..649
IstB_IS21 [PF01695], Evalue: 5.40E-07, Aligned region: 233..300
IstB_IS21 [PF01695], Evalue: 5.40E-07, Aligned region: 615..635
Arch_ATPase [PF01637], Evalue: 5.50E-07, Aligned region: 217..255
Arch_ATPase [PF01637], Evalue: 5.50E-07, Aligned region: 291..391
Arch_ATPase [PF01637], Evalue: 5.50E-07, Aligned region: 609..635
Arch_ATPase [PF01637], Evalue: 5.50E-07, Aligned region: 684..702
Zeta_toxin [PF06414], Evalue: 8.00E-06, Aligned region: 234..263
Zeta_toxin [PF06414], Evalue: 8.00E-06, Aligned region: 448..517
Zeta_toxin [PF06414], Evalue: 8.00E-06, Aligned region: 614..655
AAA_19 [PF13245], Evalue: 9.40E-06, Aligned region: 236..261
AAA_19 [PF13245], Evalue: 9.40E-06, Aligned region: 613..637
AAA_17 [PF13207], Evalue: 1.80E-05, Aligned region: 239..304
AAA_17 [PF13207], Evalue: 1.80E-05, Aligned region: 614..652
AAA_17 [PF13207], Evalue: 1.80E-05, Aligned region: 798..810
NACHT [PF05729], Evalue: 2.00E-05, Aligned region: 106..127
NACHT [PF05729], Evalue: 2.00E-05, Aligned region: 239..325
NACHT [PF05729], Evalue: 2.00E-05, Aligned region: 615..636
NACHT [PF05729], Evalue: 2.00E-05, Aligned region: 795..848
AAA_14 [PF13173], Evalue: 2.80E-05, Aligned region: 239..336
AAA_14 [PF13173], Evalue: 2.80E-05, Aligned region: 614..705
Sigma54_activat [PF00158], Evalue: 9.50E-05, Aligned region: 220..253
Sigma54_activat [PF00158], Evalue: 9.50E-05, Aligned region: 615..731
Clp_N [PF02861], Evalue: 0.0019, Aligned region: 23..59
Clp_N [PF02861], Evalue: 0.0019, Aligned region: 109..125
Clp_N [PF02861], Evalue: 0.0019, Aligned region: 453..472
RuvB_N [PF05496], Evalue: 0.002, Aligned region: 237..256
RuvB_N [PF05496], Evalue: 0.002, Aligned region: 310..319
RuvB_N [PF05496], Evalue: 0.002, Aligned region: 575..636
RNA_helicase [PF00910], Evalue: 0.0024, Aligned region: 240..261
RNA_helicase [PF00910], Evalue: 0.0024, Aligned region: 616..637
DUF258 [PF03193], Evalue: 0.0026, Aligned region: 221..257
DUF258 [PF03193], Evalue: 0.0026, Aligned region: 615..629
DUF258 [PF03193], Evalue: 0.0026, Aligned region: 792..834
AAA_18 [PF13238], Evalue: 0.0028, Aligned region: 239..264
AAA_18 [PF13238], Evalue: 0.0028, Aligned region: 616..645
SRP54 [PF00448], Evalue: 0.005, Aligned region: 239..261
SRP54 [PF00448], Evalue: 0.005, Aligned region: 614..661
AAA_33 [PF13671], Evalue: 0.0056, Aligned region: 239..256
AAA_33 [PF13671], Evalue: 0.0056, Aligned region: 614..636
AAA_28 [PF13521], Evalue: 0.009, Aligned region: 239..314
AAA_28 [PF13521], Evalue: 0.009, Aligned region: 615..635
Protein Sequence: 882 a.a.     [Download]
>gi|153947751|ref|YP_001399721.1| type VI secretion ATPase [Yersinia pseudotuberculosis IP 31758]
MEHQSAILLRRLNPYCAQALAGAATLCQTRAHAEITIEHWLLKLLEQGEGDITVIARRYEWDMDSLWQGL
LAHLETLPRTVQGKPQLSAALQQLIKSAWLDASLQENAEAVRSVHLLSALINSPSLLAADAAWPLLSLST
TQLQRLLPLLDSQSDERPEVQQAAALADSPVNLADEAATVTSASGQPQLNDALQAALDKFTLDVTAKARA
NQIDPIFGRDSEIRQMIDILSRRRKNNPILVGEPGVGKTALVEGLALRIAEGNVPDSLKTVSVRTLDLGL
LQAGAGVKGEFEQRLKNVIEAVQQSPSPVLLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIAAT
TWSEYKQYFERDAALERRFQMVKVDEPDDDTACLMLRGLKERYATHHGVHILDAAITAAVTLSRRFLTGR
QLPDKAVDLLDTAGARVRMSIDTLPTALMAINAELAALAMEQQAIEQDLLLLPNVSSTRLPEIEQRRAAL
AVGQHTLEQQYKKEKRLTTLIIEARQDIANAAHLVALQEELVQIQGNAPLLSLDVDVRTVAAVIADWTGV
PLSSLLKDEQTDLLQLENHLATRVVGQDTALGALAQRLRAAKTGLTSENGPLGVFLLVGPSGIGKTETAL
ALADSLFGGEKSLITINMSEYQEAHTVSQLKGSPPGYVGYGQGGVLTEAVRKRPYSVVLLDEVEKAHRDV
LNLFYQVFDRGFMRDGEGREIDFRNTVMVMTANLGSDHLMQLLDEQPDAPDSTLHELLRPILRDHFQPAL
LARFQTLIYRPLNAPALRTIVEMKLAQVANRLKKHYGLHCTFEASLYDTLVAACLLPDTGARNIDSLLNQ
QILPVLSQQLLSRMSEQQRTTSLTLGWDEADGITLEFEGGEK
 
Nucleotide Sequence: 2649 bp     [Download]
>gi|153946813|ref|NC_009708.1|:894308-896956 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGGAACATCAGTCAGCCATATTACTTCGCCGCTTAAATCCCTATTGCGCACAGGCACTGGCCGGTGCTG
CAACCCTGTGTCAGACCCGCGCCCATGCCGAGATCACCATTGAACATTGGTTGTTGAAACTGCTGGAGCA
GGGCGAAGGCGATATCACGGTGATTGCCCGGCGTTATGAGTGGGACATGGACAGTCTGTGGCAGGGATTG
CTGGCCCATTTGGAGACCTTACCCCGCACCGTGCAGGGCAAACCTCAGTTGTCAGCCGCGTTACAGCAGC
TGATCAAAAGTGCCTGGTTGGATGCGTCGTTGCAGGAAAATGCTGAGGCGGTACGTTCCGTTCATCTATT
ATCCGCCCTGATAAATTCGCCATCATTATTGGCCGCCGATGCTGCCTGGCCGTTGCTCAGCCTGAGCACC
ACTCAGCTACAGCGCCTGTTGCCGTTGCTGGACAGCCAATCCGACGAACGTCCTGAGGTGCAGCAGGCTG
CGGCACTGGCCGACAGCCCGGTCAATCTGGCCGATGAGGCCGCGACGGTTACCTCCGCCAGTGGTCAGCC
GCAACTGAATGACGCGCTGCAAGCGGCGCTGGATAAATTTACCCTCGATGTCACCGCCAAAGCCCGTGCC
AACCAGATTGATCCGATTTTTGGCCGCGACAGCGAGATCCGCCAGATGATTGATATCCTGTCGCGCCGCC
GTAAAAACAACCCGATTTTGGTGGGTGAACCGGGTGTGGGGAAAACCGCCTTGGTTGAAGGGCTGGCACT
GCGGATTGCCGAGGGCAACGTACCGGACAGCCTGAAAACCGTCAGTGTGCGCACACTGGATTTGGGTCTG
TTACAGGCCGGTGCCGGGGTCAAAGGCGAGTTCGAACAGCGCCTGAAAAATGTTATCGAGGCGGTGCAAC
AATCCCCCAGCCCGGTGCTGCTGTTTATCGACGAAGCCCACACCATTATCGGGGCCGGTAATCAGGCCGG
TGGTGCCGATGCGGCCAACCTGCTGAAACCGGCACTGGCGCGTGGCGAACTGCGCACCATCGCCGCCACC
ACCTGGTCCGAATACAAACAGTATTTTGAACGCGATGCCGCACTGGAGCGCCGCTTCCAGATGGTCAAAG
TGGACGAGCCGGATGATGACACCGCCTGCCTGATGCTGCGTGGCCTGAAAGAACGTTACGCCACCCATCA
CGGCGTGCATATTCTGGACGCCGCTATCACCGCAGCGGTTACCCTGTCGCGCCGCTTCCTGACCGGCCGC
CAACTGCCGGACAAAGCGGTGGATCTGCTCGATACCGCCGGTGCCCGGGTGCGCATGAGCATTGACACCT
TGCCGACTGCGCTGATGGCGATTAACGCCGAGCTGGCCGCACTGGCGATGGAGCAACAGGCCATCGAACA
GGACCTGCTCCTGTTGCCGAATGTCAGTTCAACGCGCTTACCTGAGATTGAGCAACGCCGCGCCGCGCTG
GCGGTTGGGCAGCACACACTCGAACAGCAATATAAAAAAGAAAAACGGCTGACCACCCTGATTATCGAGG
CGCGTCAGGATATCGCCAACGCGGCACATCTGGTCGCGTTGCAGGAGGAACTCGTTCAGATCCAAGGCAA
CGCGCCGCTGCTGTCGCTGGACGTTGATGTGCGCACTGTTGCGGCTGTGATCGCCGACTGGACCGGCGTG
CCGCTGAGCAGTCTGTTGAAAGACGAACAGACCGATTTGTTGCAACTGGAAAACCATCTCGCCACCCGCG
TAGTCGGGCAGGATACGGCGCTGGGTGCGCTGGCGCAACGGCTGCGGGCGGCGAAAACCGGGCTGACATC
AGAGAATGGCCCGCTGGGGGTGTTCCTGCTGGTCGGGCCGAGTGGGATCGGCAAAACCGAAACCGCGCTG
GCACTGGCCGACAGCCTGTTCGGTGGCGAGAAATCGCTGATCACCATCAACATGTCCGAATATCAGGAAG
CACACACCGTCTCCCAATTGAAAGGGTCGCCCCCGGGCTATGTCGGCTACGGTCAGGGCGGCGTATTGAC
CGAAGCGGTGCGCAAACGGCCTTACAGCGTGGTGCTGCTGGATGAAGTCGAGAAGGCCCATCGTGATGTG
CTGAACCTGTTCTATCAGGTGTTTGACCGCGGTTTTATGCGCGACGGTGAAGGGCGCGAAATTGATTTCC
GCAACACGGTGATGGTGATGACCGCCAATCTGGGCAGTGATCATCTGATGCAGTTGCTGGATGAGCAACC
GGACGCGCCGGACAGCACCCTGCATGAACTGCTGCGGCCAATATTGCGCGACCACTTCCAGCCCGCGCTG
CTGGCCCGCTTCCAGACGCTGATCTACCGCCCACTGAATGCCCCCGCGCTGCGCACCATCGTCGAAATGA
AACTGGCACAGGTCGCTAACCGCCTCAAAAAACATTACGGCTTGCACTGCACTTTTGAAGCAAGCCTGTA
CGACACACTGGTCGCCGCCTGCCTGCTGCCGGACACCGGCGCACGCAACATCGACAGCCTGCTCAATCAG
CAGATTTTACCGGTATTGAGCCAGCAGCTGTTAAGCCGCATGAGCGAGCAACAGCGCACCACCTCGCTGA
CGCTGGGCTGGGATGAAGCCGACGGCATTACCCTTGAATTTGAAGGAGGCGAAAAATGA