SecReT6
Protein ID: 153947791
SecReT6 ID221
T6SS typei2
Gene symbol-
Locus tagYpsIP31758_0727
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]888186..889736 [+]
Producthypothetical protein
NoteTssC
UniProt IDA7FEN8
KEGG IDypi:YpsIP31758_2510, ypi:YpsIP31758_0727
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 6.70E-177, Aligned region: 15..53
DUF877 [PF05943], Evalue: 6.70E-177, Aligned region: 92..512
Protein Sequence: 516 a.a.     [Download]
>gi|153947791|ref|YP_001399716.1| hypothetical protein YpsIP31758_0727 [Yersinia pseudotuberculosis IP 31758]
MLMSVQENRAQGTATTVLKNSPAAQGVYAALFEKINLSPVSSLAGIEAFQNNDALAEATTDERVTAAVSV
FLDLLKQSAKKVEKLDKTLLDGHIAALDDQISRQLDAVMHHPDFQRVESTWRGVKSLIDQTDFRQNVRIE
LLDISKDHLVQDFEDAPEISQSGLYAQTYIQEYDTPGGEPIAAAISNYEFDRGPQDIALLRNISKVAAAA
HMPFIGSVGPAFFGKENMEEVAAIKDIGNYFDRAEYIKWKAFRDSDDSRYIGLTMPRVLGRLPYGPDTVP
VRSFNYVEQVKGPDHERYLWTNASFAFAANMVKSFIKNGWCVQIRGPQAGGAVTNLPIHLYDLGTGNQVK
IPSEVMIPETREFEFANLGFIPLSYYKNRDYSCFFSANSAQKPALYDTADATANSRINARLPYIFLLSRI
AHYLKLIQRENIGTTKDRRLLELELNNWVRGLVTEMTDPGDDLQASHPLRDAKVTVEDIEDNPGFFRVKL
YAVPHFQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1551 bp     [Download]
>gi|153946813|ref|NC_009708.1|:888186-889736 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGCTGATGTCTGTACAGGAAAACCGTGCGCAGGGTACTGCGACGACCGTATTAAAGAATAGCCCTGCGG
CACAAGGGGTTTACGCCGCCTTGTTTGAAAAAATCAACCTGAGCCCGGTCTCCTCACTGGCCGGTATCGA
GGCGTTCCAGAACAACGATGCGCTGGCGGAAGCCACCACCGATGAGCGCGTTACCGCCGCCGTCAGTGTC
TTTTTAGACCTGCTGAAGCAGTCGGCGAAGAAAGTAGAAAAACTGGATAAAACCCTGCTGGACGGCCATA
TTGCCGCACTGGATGACCAAATCAGCCGCCAGTTGGACGCGGTAATGCACCACCCCGATTTCCAGCGGGT
GGAATCGACCTGGCGTGGTGTGAAGTCGCTGATCGATCAGACCGATTTCCGCCAGAACGTGCGCATCGAG
CTGCTGGATATCAGTAAAGATCATCTGGTGCAGGATTTTGAAGATGCCCCAGAAATTTCACAAAGCGGTT
TATACGCCCAGACCTATATTCAGGAATACGACACCCCCGGCGGTGAACCGATTGCTGCGGCTATCTCCAA
CTACGAGTTTGACCGTGGCCCGCAGGATATCGCCTTATTGCGCAATATCTCCAAGGTAGCCGCGGCGGCC
CATATGCCGTTTATCGGCTCAGTGGGTCCGGCGTTCTTTGGTAAAGAGAACATGGAAGAGGTGGCGGCCA
TCAAAGATATCGGCAACTACTTTGACCGTGCCGAATACATCAAATGGAAAGCTTTCCGCGACTCGGATGA
TTCCCGCTATATCGGCCTGACCATGCCGCGCGTACTGGGGCGTTTGCCTTATGGGCCAGACACCGTGCCG
GTGCGCAGCTTTAACTACGTAGAGCAGGTGAAAGGGCCGGATCATGAGCGTTATCTGTGGACCAACGCTT
CGTTTGCCTTTGCTGCCAACATGGTGAAAAGCTTCATTAAAAATGGCTGGTGTGTGCAGATCCGTGGCCC
GCAGGCCGGTGGTGCCGTCACCAACTTACCGATCCACCTGTACGATCTGGGTACCGGTAATCAGGTCAAA
ATTCCGTCAGAAGTGATGATCCCGGAAACCCGCGAGTTCGAGTTTGCCAATCTGGGCTTTATCCCGCTGT
CGTACTACAAAAACCGCGATTACTCGTGCTTCTTCTCGGCCAACTCGGCGCAGAAACCGGCGCTGTATGA
CACCGCGGATGCCACGGCCAACAGCCGCATCAACGCCCGTTTGCCGTATATCTTCCTGCTGTCGCGCATT
GCCCATTATCTGAAACTGATCCAGCGCGAGAACATCGGCACCACCAAAGATCGCCGTCTGCTGGAGCTGG
AGCTGAACAACTGGGTGCGCGGGCTGGTGACGGAAATGACTGATCCGGGTGATGATTTGCAGGCGTCCCA
TCCCCTGCGTGATGCCAAAGTGACGGTCGAAGATATCGAAGACAACCCCGGCTTCTTCCGCGTCAAGCTG
TATGCGGTACCGCATTTCCAGGTGGAAGGGATGGACGTCAATCTGTCATTGGTTTCCCAAATGCCAAAGG
CTAAGGCATAA