SecReT6
Protein ID: 153947844
SecReT6 ID224
T6SS typei2
Gene symbol-
Locus tagYpsIP31758_2486
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]2809545..2809997 [-]
Producthypothetical protein
NoteTssE
UniProt IDA7FJM7
KEGG IDypi:YpsIP31758_2486
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.00E-14, Aligned region: 31..116
Protein Sequence: 150 a.a.     [Download]
>gi|153947844|ref|YP_001401455.1| hypothetical protein YpsIP31758_2486 [Yersinia pseudotuberculosis IP 31758]
MPDTSSPSLYEQLLGNFTGGLDLHQVSDENQVILSVLDNMQRILNCRAGTLSHLPDYGLPDMSKILQGLP
GSAHSLLTTLSATLLKYEPRLKSLQVILLPQTTPGHLEYAIDAELKGLGLVRYGTAFMPEGRVLMRHLKQ
QHYLNQRESF
 
Nucleotide Sequence: 453 bp     [Download]
>gi|153946813|ref|NC_009708.1|:c2809997-2809545 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGCCGGACACCTCCTCGCCATCGTTGTATGAGCAATTGTTGGGCAATTTCACCGGCGGGCTTGACCTGC
ATCAGGTCAGTGACGAAAACCAGGTCATTCTCTCGGTGCTGGACAATATGCAACGCATTCTTAATTGTCG
GGCCGGAACACTCAGTCATCTGCCCGATTATGGCCTGCCGGACATGAGTAAAATTCTGCAGGGGTTGCCG
GGCAGCGCGCATTCGCTGCTGACCACGCTGTCCGCCACCTTGCTGAAATACGAGCCGCGTCTGAAAAGTT
TGCAGGTGATTCTGTTGCCACAGACCACACCCGGTCATCTGGAATACGCCATTGATGCGGAGCTGAAAGG
GCTGGGACTGGTGCGCTATGGCACGGCGTTTATGCCGGAGGGCAGGGTGTTGATGCGCCACCTTAAACAA
CAACACTACCTCAATCAGCGGGAGTCATTTTGA