SecReT6
Protein ID: 153947888
SecReT6 ID220
T6SS typei1
Gene symbol-
Locus tagYpsIP31758_0327
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]381613..382926 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDA7FDJ3
KEGG IDypi:YpsIP31758_0327
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 1.20E-48, Aligned region: 90..154
DUF3702 [PF12486], Evalue: 1.20E-48, Aligned region: 284..431
ImpA-rel_N [PF06812], Evalue: 5.80E-22, Aligned region: 41..101
Protein Sequence: 437 a.a.     [Download]
>gi|153947888|ref|YP_001399321.1| ImpA domain-containing protein [Yersinia pseudotuberculosis IP 31758]
MSDTPQHIIIKTGTDPRNRPEFNAIREEINKINHPARPEVNWGLIESLALTLFRTHGVDLQTAVYYTLAR
TQKNGLAGFTEGCELLAGMVVGQWDHLWPEQPQARSEILEWFNTRVSNQLRQHDFTRDDLRLVYRAERAL
QLLYDKLQQVELKRVPRIENLLYLMQNTAKKLESASDAAKAQQTAAPLKMPPMVYLSVPEAEPVRTAAAA
PEPAANIEVRSPPPETKRGAVLWGFGAGVLCSLLVATAVYVTQFKPLQQQMTVLATQPESAALLWLNRPD
VATYGEQLSTLENLSPLFVLNTADQSVAMARQRWPSDPSQVAESQRWARLVEARIGLAGTDSSYFQLQQR
LHALSEKLLEQERSRGSLTISYLKTAVYQMQTELNREIPLEELLRQLAVSADEHQPASPVLIKQIDDRWN
ALLSRYHHLTQQTNSAR
 
Nucleotide Sequence: 1314 bp     [Download]
>gi|153946813|ref|NC_009708.1|:381613-382926 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGAGTGACACCCCGCAACATATCATCATTAAAACCGGCACTGACCCACGGAACCGGCCGGAATTTAACG
CCATTCGTGAAGAGATCAACAAAATCAACCACCCGGCACGGCCAGAGGTCAACTGGGGTTTGATTGAATC
ACTGGCGCTGACCCTGTTCCGTACCCACGGCGTGGATTTGCAGACGGCGGTGTATTACACGCTGGCCCGC
ACCCAAAAAAATGGCCTGGCCGGTTTCACCGAGGGCTGCGAGTTGCTGGCCGGTATGGTGGTCGGCCAGT
GGGATCACCTGTGGCCAGAACAGCCGCAGGCACGCAGTGAAATACTGGAATGGTTCAATACCCGCGTCAG
CAATCAACTGCGTCAGCATGATTTTACCCGTGACGATCTTCGGCTGGTGTACCGCGCTGAGCGGGCCTTG
CAGTTGCTGTACGATAAATTGCAACAGGTTGAATTAAAACGGGTACCGCGCATTGAAAACCTGCTGTACC
TGATGCAGAACACCGCCAAAAAACTCGAATCGGCCAGTGACGCGGCGAAGGCTCAGCAAACTGCGGCCCC
GCTGAAAATGCCGCCTATGGTCTATCTCTCGGTACCCGAGGCCGAGCCTGTCCGGACGGCAGCGGCAGCC
CCTGAGCCTGCGGCCAATATTGAGGTGCGTTCGCCCCCCCCGGAGACCAAACGGGGGGCGGTGCTGTGGG
GCTTTGGTGCCGGTGTCCTGTGCAGTTTACTGGTGGCGACTGCGGTTTACGTTACCCAGTTCAAACCGCT
GCAACAGCAAATGACGGTGCTGGCCACCCAACCGGAAAGCGCGGCATTGCTGTGGCTCAACCGCCCGGAT
GTCGCCACCTATGGTGAGCAACTGAGCACCCTGGAAAACCTCTCGCCCCTGTTTGTGCTCAATACCGCCG
ACCAGTCGGTGGCGATGGCTCGTCAACGCTGGCCGTCCGATCCCAGTCAGGTGGCCGAAAGCCAGCGCTG
GGCGCGGTTGGTGGAGGCGCGTATCGGCCTGGCCGGTACCGACAGCAGCTATTTCCAGCTCCAGCAGCGC
TTGCATGCGCTGTCTGAAAAATTACTCGAACAGGAACGTTCTCGGGGCAGTCTGACTATCTCCTATCTAA
AAACAGCAGTTTACCAGATGCAGACCGAGCTGAACCGGGAGATACCGCTGGAGGAGTTACTGCGCCAGCT
GGCGGTGTCCGCCGATGAACATCAACCGGCCTCGCCGGTCTTGATAAAACAAATTGATGACCGCTGGAAC
GCCTTACTCAGCCGTTATCACCACTTAACGCAGCAGACGAACTCTGCCCGTTAA