SecReT6
Protein ID: 153947945
SecReT6 ID222
T6SS typei2
Gene symbol-
Locus tagYpsIP31758_0777
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]932854..933354 [+]
Producthypothetical protein
NoteTssB
UniProt IDA7FET4
KEGG IDypi:YpsIP31758_0777
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.90E-55, Aligned region: 7..159
Protein Sequence: 166 a.a.     [Download]
>gi|153947945|ref|YP_001399762.1| hypothetical protein YpsIP31758_0777 [Yersinia pseudotuberculosis IP 31758]
MSSSSFQNEIPKARINIKLDLHTGGAQKKMELPLKLLVMGDYSNGQEQRPLSEREKLNINKNNFNSVLAE
FQPSLKLSVPDTLAADNTDTAVALTFRDMKDFEPENVARQIPQLRALLAMRNLLRDLKSNLLDNATFRRE
LENILKDETLSDELRAELAALAPKEC
 
Nucleotide Sequence: 501 bp     [Download]
>gi|153946813|ref|NC_009708.1|:932854-933354 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGTCCTCTTCAAGCTTCCAAAATGAGATACCTAAAGCACGCATTAATATTAAGCTTGACCTGCATACAG
GTGGCGCTCAAAAGAAAATGGAGTTGCCTTTAAAGTTATTGGTGATGGGTGATTACAGCAACGGCCAGGA
ACAGCGCCCGCTGTCGGAACGTGAAAAACTCAATATCAACAAAAACAATTTTAACAGTGTTCTGGCTGAG
TTCCAACCGAGCCTGAAACTCTCAGTCCCTGACACGCTGGCAGCGGATAACACTGATACTGCTGTCGCTT
TGACCTTCCGTGACATGAAAGATTTCGAACCGGAAAACGTCGCCCGTCAAATCCCGCAACTGCGTGCCTT
GCTGGCCATGCGCAACCTGCTACGTGACCTCAAATCCAATCTTTTGGACAACGCTACCTTCCGTCGCGAG
CTGGAAAATATCCTCAAAGACGAAACATTGAGTGACGAGCTGCGTGCTGAATTGGCGGCATTAGCCCCAA
AAGAGTGTTAA