SecReT6
Protein ID: 153948159
SecReT6 ID222
T6SS typei2
Gene symbol-
Locus tagYpsIP31758_0797
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]959627..960685 [+]
ProductPAAR domain-containing protein
NotePAAR
UniProt IDA7FEV3
KEGG IDypi:YpsIP31758_0797
PDB IDNA
Domain hit(s) vs Pfam Toxin_60 [PF15607], Evalue: 6.10E-28, Aligned region: 194..303
PAAR_motif [PF05488], Evalue: 6.50E-10, Aligned region: 10..53
Protein Sequence: 352 a.a.     [Download]
>gi|153948159|ref|YP_001399781.1| PAAR domain-containing protein [Yersinia pseudotuberculosis IP 31758]
MAKGYYLGVGDQTTCGGVIIEGDATHILMGKAVAREQDRVTCGKHPGTYIIVGHIPGDSIHGRKFAGTLN
SQSNCPCKAWFIPSLVHDTYEFGARSKSQNMSEISTEVEREMVENVSESEEKSKVVCAHIDGALVVASYI
LDEIKKNVKSDTADKIRSFIDNDLYKKRLKEWQDSPWYARMNAPPQPEIISASVLWFMAVKSGAKWDHKP
KIRDQFKAYAVSRPLVGSGTRSKSYFHKYEEHDYFYDVWSNIHYGYVGLSLGFDESYLLLGSTLEQVRTS
IGSKPDPIDDITCMKIGYALYHQHGKYAETLDVRHILDALESASDLDLAISRQIHWCWNNDNSSQIDHPQ
GK
 
Nucleotide Sequence: 1059 bp     [Download]
>gi|153946813|ref|NC_009708.1|:959627-960685 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGGCAAAAGGTTATTACCTTGGTGTTGGGGATCAAACAACCTGTGGTGGCGTGATCATCGAAGGTGATG
CCACTCATATCCTGATGGGCAAAGCCGTGGCCCGTGAGCAAGATAGAGTAACCTGCGGCAAGCATCCGGG
AACTTATATCATTGTCGGCCACATTCCCGGTGATTCTATTCATGGCCGTAAGTTTGCTGGCACCTTGAAT
AGTCAAAGCAATTGCCCGTGCAAGGCGTGGTTTATTCCTTCTTTGGTGCATGATACGTATGAGTTTGGTG
CAAGAAGTAAATCACAAAATATGTCTGAAATTAGTACTGAAGTCGAACGTGAGATGGTAGAAAATGTGAG
TGAATCAGAAGAAAAATCTAAAGTTGTCTGTGCCCATATTGATGGCGCTTTAGTAGTAGCGAGTTATATC
CTTGATGAAATAAAGAAAAATGTAAAAAGTGATACCGCTGATAAAATCAGATCTTTTATCGATAATGACC
TCTATAAAAAAAGACTTAAGGAGTGGCAGGATTCTCCTTGGTACGCGAGAATGAATGCACCTCCACAGCC
TGAAATAATATCGGCATCGGTTTTATGGTTTATGGCGGTCAAGAGTGGTGCTAAATGGGATCATAAACCT
AAAATTAGAGATCAATTTAAAGCATATGCAGTTTCTCGTCCTCTGGTCGGAAGCGGAACCCGATCAAAAA
GCTATTTTCATAAATATGAAGAACATGATTATTTTTATGATGTCTGGTCCAATATTCACTATGGTTATGT
AGGCTTAAGTCTTGGTTTTGATGAGTCATATTTATTACTTGGCTCAACTCTTGAGCAAGTAAGAACCAGC
ATCGGGAGTAAACCAGATCCTATAGATGATATTACATGTATGAAAATTGGCTATGCACTCTATCATCAAC
ATGGAAAATATGCTGAGACGTTAGATGTCAGGCATATACTCGATGCTCTTGAATCAGCATCGGACCTTGA
TCTAGCTATTTCAAGACAAATTCATTGGTGTTGGAATAATGATAATTCGAGTCAAATTGATCACCCGCAG
GGTAAGTAA