SecReT6
Protein ID: 153948365
SecReT6 ID220
T6SS typei1
Gene symbol-
Locus tagYpsIP31758_0319
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]369750..370295 [+]
Productlipoprotein
NoteTssJ
UniProt IDA7FDI5
KEGG IDypi:YpsIP31758_0319
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.60E-35, Aligned region: 17..174
Protein Sequence: 181 a.a.     [Download]
>gi|153948365|ref|YP_001399313.1| lipoprotein [Yersinia pseudotuberculosis IP 31758]
MNNARGYLLTWALCVVFLLSGCSGAWEATKKVGKVVMDPDIPVGQAADQPSTVRLTLLSDRDTNPNEKGE
AAPTEIVVVYLSENSKLLAADYDQLSSDALEKTLGKNYIDHQEYTLLPDQFKALDPIKLEEKNSYLGVIA
HYADANRSEWKKIIKIKGIGHNYQVLVHVRSNDVDLRKEEE
 
Nucleotide Sequence: 546 bp     [Download]
>gi|153946813|ref|NC_009708.1|:369750-370295 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGAACAACGCCAGAGGCTATCTCCTGACGTGGGCATTATGTGTAGTGTTCCTATTGTCTGGGTGCAGCG
GTGCATGGGAAGCCACTAAAAAGGTCGGCAAGGTGGTTATGGACCCCGATATTCCGGTGGGGCAGGCTGC
TGATCAACCCTCAACGGTCAGGCTAACATTGCTGTCCGATCGCGATACCAACCCTAATGAAAAAGGGGAA
GCGGCCCCGACTGAGATAGTGGTGGTGTACCTAAGTGAAAACTCCAAGCTGCTGGCCGCGGATTATGATC
AGCTAAGCAGTGACGCGCTGGAGAAAACGCTGGGTAAGAATTACATCGATCATCAGGAATACACCTTACT
GCCCGATCAATTCAAGGCGCTGGACCCTATCAAGCTGGAAGAGAAAAACAGCTATCTGGGGGTGATTGCT
CACTATGCCGATGCCAACCGCAGTGAATGGAAGAAGATCATCAAAATAAAAGGGATCGGCCATAACTACC
AGGTTTTGGTCCATGTCAGATCAAACGATGTCGATCTAAGGAAAGAGGAAGAATAA