SecReT6
Protein ID: 153948566
SecReT6 ID224
T6SS typei2
Gene symbol-
Locus tagYpsIP31758_2485
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]2808154..2809521 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDA7FJM6
KEGG IDypi:YpsIP31758_2485
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.20E-50, Aligned region: 116..150
DUF3702 [PF12486], Evalue: 2.20E-50, Aligned region: 303..448
ImpA-rel_N [PF06812], Evalue: 3.50E-20, Aligned region: 40..100
ImpA-rel_N [PF06812], Evalue: 3.50E-20, Aligned region: 231..244
Protein Sequence: 455 a.a.     [Download]
>gi|153948566|ref|YP_001401454.1| ImpA domain-containing protein [Yersinia pseudotuberculosis IP 31758]
MISNIERTLKTGGDPRALADFTTLRGELNKLAHPARPDVDWARVEQLCLALFRQNGVELQTAVDFTLART
HTVGLAGLCEGLELLAGLVCHQWRGLWPPQTHARVALLAWLSDRLQQVWRTMTLCYGDLAQVYRAERALE
QLCTQLQTLELKHLCKLDGVRLMLHNAAQRLESTEAVSGLAKPRGASEPPESLRFASVPVSEPLVYIISE
PAPPPVQVVLPASPPRWKAGHGFAAGLSLMAVLMAGSFVIWQSVSSDPVRETLLATASPLPIPLSANSIA
ELKKQASDVEWARLAEPVLQASATQLDQLAQLPPLWAQARGDALLSQAQQLWPASQEVKRLSTLWQQQRA
AGAAPLVELKHYALAQDRLRQLAERLNSLDEKKRGYMTVSELKSAVFAIQQPLAQAVPLEELLRQYQEQL
ESGQTPSSALRQQIDSRFSQLLNRYALLIASPGVQ
 
Nucleotide Sequence: 1368 bp     [Download]
>gi|153946813|ref|NC_009708.1|:c2809521-2808154 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGATATCGAATATTGAACGCACACTGAAAACCGGTGGCGACCCGCGTGCACTGGCGGATTTCACCACAC
TGCGGGGTGAATTAAATAAACTGGCCCACCCGGCCCGTCCGGATGTTGACTGGGCGCGGGTTGAGCAACT
GTGTCTGGCGCTATTTCGCCAGAACGGCGTTGAGTTACAGACTGCCGTTGATTTTACCCTGGCACGAACG
CACACCGTTGGGTTGGCGGGCTTATGTGAAGGGCTGGAACTGTTGGCGGGGTTGGTCTGCCATCAATGGC
GTGGGTTATGGCCACCGCAAACGCATGCCCGGGTGGCGTTACTGGCCTGGTTGAGCGACCGGCTGCAGCA
AGTGTGGCGCACCATGACGCTGTGCTACGGTGACCTGGCGCAGGTGTACCGGGCAGAGCGGGCGCTGGAA
CAGTTGTGTACGCAGTTGCAAACGCTGGAGCTCAAACATTTGTGCAAGCTGGACGGGGTTCGTTTGATGC
TGCATAACGCGGCGCAGCGGTTGGAAAGTACCGAGGCCGTGTCTGGCCTTGCGAAACCACGGGGTGCCTC
TGAACCGCCCGAGTCGCTGCGATTTGCCTCTGTCCCGGTCAGTGAACCACTGGTGTATATTATCAGCGAA
CCGGCCCCGCCACCTGTTCAGGTGGTTTTACCTGCCTCACCTCCGCGCTGGAAGGCGGGCCACGGTTTTG
CCGCGGGGTTATCGTTGATGGCGGTGCTGATGGCCGGCAGTTTCGTTATCTGGCAGTCGGTATCATCGGA
TCCCGTGAGGGAAACATTGCTGGCCACTGCCAGTCCTTTGCCGATACCGCTGAGTGCTAACTCAATAGCT
GAACTGAAAAAACAGGCTTCAGATGTTGAGTGGGCACGTCTGGCGGAACCGGTGTTGCAAGCCAGTGCGA
CGCAGTTAGATCAACTGGCACAGTTACCGCCGTTATGGGCGCAGGCTCGGGGGGATGCCTTGCTATCTCA
GGCGCAACAACTGTGGCCCGCGAGTCAAGAGGTCAAACGGTTGAGCACTTTGTGGCAGCAACAGCGAGCA
GCCGGTGCTGCGCCCTTGGTAGAGTTGAAACACTATGCATTGGCGCAAGACCGTTTGCGGCAACTGGCAG
AACGACTGAATAGTCTGGATGAGAAAAAACGCGGATATATGACGGTCTCCGAACTGAAATCTGCCGTCTT
TGCTATCCAACAGCCGCTGGCACAGGCCGTGCCACTGGAAGAACTGCTGCGGCAATATCAGGAACAATTA
GAATCAGGGCAAACTCCATCCTCAGCACTGCGTCAACAGATTGACAGCCGGTTTAGTCAATTGCTGAACC
GCTATGCGTTGCTGATCGCATCTCCTGGCGTTCAGTAA