SecReT6
Protein ID: 153948603
SecReT6 ID223
T6SS typei3
Gene symbol-
Locus tagYpsIP31758_1360
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]1591502..1592527 [-]
Producthypothetical protein
NoteTssG
UniProt IDA7FGG1
KEGG IDypi:YpsIP31758_1360
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-88, Aligned region: 22..321
Protein Sequence: 341 a.a.     [Download]
>gi|153948603|ref|YP_001400339.1| hypothetical protein YpsIP31758_1360 [Yersinia pseudotuberculosis IP 31758]
MLPDESVHQEKHANLDAWYQESQPWNAGFISMMRANAARNPTLPAPGKAPLPEQEAFRIGQSAHMTFSPR
EISHAVMKDGKMDLQLFGLGIWGPNGAMPLQMTELAYTRAELHDHTMTDFVDLFHHRALSQLYRAWFVSQ
DTASLDRQSDEKFSFYVGSLAGLDPQELNDTELPVHARLASSAHLIREARNPEGLVGALQYYFDVPVRMV
EYAEQWIFLEESDQTQLGDGAGAMLLGDGAILGNTVLDRQHKFQLILGPLSLQQYLRFSLWGQDLPVLRE
WVRNFVGFEYAWEVQLLLSADEVPMATLDGGHQLGYTSWLARSDTTLDVGGMSFEPEMHHD
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|153946813|ref|NC_009708.1|:c1592527-1591502 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGTTGCCCGATGAATCCGTTCACCAGGAAAAACATGCCAATCTGGACGCCTGGTATCAGGAGTCTCAGC
CATGGAACGCCGGTTTTATCAGCATGATGCGGGCGAATGCCGCCCGCAACCCTACCCTGCCAGCGCCAGG
AAAAGCGCCCTTGCCTGAACAGGAAGCCTTCCGCATCGGGCAAAGTGCGCACATGACGTTCTCTCCGCGT
GAGATATCTCATGCGGTTATGAAAGACGGGAAAATGGATCTGCAACTTTTTGGCTTAGGGATTTGGGGGC
CAAATGGTGCGATGCCGCTTCAGATGACCGAACTGGCCTATACCCGTGCCGAGTTGCATGATCATACGAT
GACGGACTTCGTCGACCTTTTTCATCACCGCGCATTATCACAGCTTTATCGGGCGTGGTTTGTCTCTCAG
GATACCGCCTCGCTAGACCGGCAGAGTGATGAAAAATTCTCCTTCTATGTCGGTAGTCTGGCCGGGCTGG
ATCCTCAAGAACTTAATGACACCGAACTCCCGGTTCATGCCCGGTTAGCCTCCTCTGCCCATTTGATTCG
TGAAGCGCGCAACCCCGAAGGGCTCGTGGGCGCATTGCAGTATTACTTTGACGTCCCCGTGCGGATGGTG
GAGTACGCCGAGCAGTGGATCTTTCTGGAAGAAAGCGACCAGACACAATTGGGTGATGGTGCCGGCGCGA
TGCTCTTGGGCGACGGTGCTATTTTGGGCAATACCGTTTTGGATCGGCAGCATAAATTTCAACTGATCCT
CGGCCCCCTCAGCCTGCAACAGTACCTGCGCTTTAGCCTCTGGGGACAAGACTTACCAGTATTGCGAGAG
TGGGTACGTAACTTTGTTGGGTTCGAATACGCCTGGGAAGTCCAGTTGTTGTTAAGCGCCGATGAGGTTC
CCATGGCAACACTCGATGGCGGACATCAATTGGGATACACCTCTTGGTTAGCCCGCAGTGATACCACCCT
TGATGTCGGTGGGATGAGTTTTGAGCCTGAAATGCATCACGATTAA