SecReT6
Protein ID: 153948683
SecReT6 ID224
T6SS typei2
Gene symbol-
Locus tagYpsIP31758_2504
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]2833254..2835602 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA7FJP4
KEGG IDypi:YpsIP31758_2504
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.40E-66, Aligned region: 34..355
DUF2345 [PF10106], Evalue: 9.70E-47, Aligned region: 611..751
T6SS_Vgr [PF13296], Evalue: 1.80E-35, Aligned region: 488..591
Phage_base_V [PF04717], Evalue: 3.80E-16, Aligned region: 390..481
Protein Sequence: 782 a.a.     [Download]
>gi|153948683|ref|YP_001401472.1| Rhs element Vgr protein [Yersinia pseudotuberculosis IP 31758]
MNTFLPTLRFDHSHHKLVVRDSTAAVDVLGFEGHESLSQPFCYDIQFTSADKAIDPATMLMQDASLTLAA
PVAEAFGVTVQQTQRVIQGVVTGFKRLSASKEECRYELSLQPRLALLSRSHQNGIYQDMSVPQIVEKILR
ERHDMRGQDFVFTLAREYPRREQVMQYGEDDLTFIRRLLAEVGIWFRFTADPKLNIDVVEFYDDQRFYPS
GLTLQAVPPSGLHDSGTESVWDLSSAHQVVEKSVSTGDYNYRTATADLTAGADITRGDTTTYGEAYHYAD
NYLTAGSEGREPESESGAFYARLRHERYLNNQARFAGVANAAALAPGQELNVTGNDVPAQFGKGVIITRI
TSHARRDRSYEVHFEAIPYSEDYCFRPALIRKPTMAGTLPARVTSTTANDTYGHIDKDGRYRVNLMFDRD
SWESGYESLWVRQARPYAGDTYGLHLPLLAGTEVAIAFEDGNPDRPYIASVLHDSAHGDHVTISNYKRNV
LRTPSNNKLRLEDERGKEHIKLSTEYGGKSQLNLGHLVDNEKQPRGEGFELRTDSFGALRAEKGIFISAD
GQAKAQGQVLEMQPAISLLKSAQEQMEAISADAQTATASPANLQVQISLLQQNLTELKQAVLLLSAPKGI
ALSSGEHLQMSTSDNLIATAGKNTDVSVAKNFFIGVGNTLSIFVRKLGMKLIANQGSITVQAQNDLMELL
ARKAITITSTEDEIKITAKKRITLNAGGSYITLDENRIESGTAGEYLTKAGYYGRLDKAKLPTEFPALAA
KTEDPIKRWLFS
 
Nucleotide Sequence: 2349 bp     [Download]
>gi|153946813|ref|NC_009708.1|:c2835602-2833254 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGAATACCTTTCTCCCGACTCTTCGGTTTGACCATAGCCACCACAAACTGGTGGTCCGCGACAGCACCG
CCGCCGTTGATGTGCTGGGCTTTGAAGGCCATGAAAGCCTGAGCCAGCCGTTCTGTTACGACATCCAATT
CACCAGCGCCGACAAGGCGATTGACCCGGCCACCATGTTGATGCAGGACGCGTCACTGACATTGGCGGCC
CCGGTGGCTGAAGCCTTTGGTGTGACGGTTCAGCAGACCCAACGGGTGATCCAAGGGGTGGTGACCGGGT
TTAAACGTCTGTCGGCCTCGAAAGAGGAATGCCGCTACGAACTGAGCCTGCAACCGCGCCTGGCCTTGCT
GTCGCGCAGCCATCAGAACGGGATATATCAGGACATGTCGGTGCCGCAGATTGTGGAAAAAATTCTGCGT
GAGCGCCATGATATGCGCGGTCAGGATTTTGTCTTCACCCTGGCCCGCGAGTACCCGCGCCGCGAGCAGG
TGATGCAGTACGGCGAAGATGACCTGACCTTTATCCGCCGCCTGCTGGCGGAAGTGGGGATCTGGTTTCG
TTTTACCGCCGATCCCAAACTCAATATTGATGTGGTGGAGTTTTACGACGACCAGCGCTTTTACCCGTCA
GGGCTGACGCTACAGGCAGTGCCCCCTTCGGGCCTGCACGACAGCGGGACGGAGTCGGTCTGGGATTTGT
CCAGTGCCCATCAGGTGGTGGAAAAATCGGTCAGTACCGGCGATTACAACTACCGCACCGCCACTGCCGA
CCTGACCGCCGGGGCCGACATCACGCGCGGCGATACCACCACCTACGGCGAAGCCTATCATTACGCCGAT
AACTATCTGACCGCAGGCAGCGAAGGGCGCGAGCCGGAAAGTGAAAGTGGGGCCTTTTATGCCCGTCTGC
GCCATGAACGTTACCTCAATAATCAGGCGCGCTTCGCCGGGGTGGCCAATGCGGCGGCACTGGCACCGGG
TCAGGAACTGAACGTCACCGGCAACGACGTGCCAGCACAGTTTGGTAAAGGGGTGATAATCACCCGCATC
ACCAGCCATGCCCGCCGCGACCGCAGCTATGAAGTACATTTTGAAGCCATTCCTTACTCCGAGGATTATT
GCTTCCGTCCGGCGCTGATCCGCAAGCCGACCATGGCCGGGACCTTGCCGGCGCGGGTGACCAGTACCAC
TGCTAACGACACTTATGGTCATATCGACAAAGACGGGCGCTACCGTGTCAACCTGATGTTCGACCGTGAC
AGTTGGGAGTCGGGTTACGAAAGCCTTTGGGTTCGTCAGGCCCGCCCGTATGCGGGTGACACCTACGGCC
TGCACCTGCCGCTGCTGGCGGGCACCGAAGTGGCGATTGCGTTTGAAGATGGCAATCCGGACCGGCCGTA
TATTGCCTCTGTGTTGCACGACTCGGCGCACGGCGACCATGTCACCATCAGTAATTACAAACGTAACGTA
CTGCGTACTCCGTCGAATAACAAACTGCGCCTTGAAGATGAACGGGGTAAAGAGCACATCAAGCTCAGCA
CCGAATACGGCGGCAAAAGCCAGTTGAATCTGGGGCATCTGGTCGATAACGAGAAACAGCCTCGGGGTGA
GGGTTTTGAGCTGCGCACCGACAGTTTTGGTGCCTTGCGGGCAGAAAAAGGGATTTTCATCAGCGCTGAC
GGCCAGGCGAAGGCACAGGGGCAGGTGCTGGAGATGCAACCGGCTATCAGCCTGTTGAAAAGTGCGCAGG
AACAGATGGAGGCCATCTCCGCGGATGCACAAACCGCCACCGCCAGTCCGGCCAACCTACAGGTACAAAT
CAGTCTGTTGCAGCAAAACCTCACTGAACTGAAACAAGCTGTCCTGTTACTGAGTGCGCCAAAGGGGATC
GCGTTGAGCAGCGGGGAGCATCTGCAAATGAGTACCAGCGATAACCTGATTGCCACCGCAGGTAAAAATA
CCGACGTCAGCGTCGCGAAAAACTTCTTTATCGGCGTAGGCAATACCCTAAGTATCTTCGTCAGAAAGCT
GGGGATGAAACTAATAGCCAATCAGGGGTCGATAACAGTCCAGGCCCAGAATGATCTAATGGAGTTATTG
GCGCGTAAAGCGATCACGATCACCAGCACCGAGGATGAGATAAAAATCACCGCCAAGAAGAGGATCACGC
TGAATGCGGGAGGCAGTTATATCACGCTGGATGAGAATCGGATCGAGTCAGGAACGGCGGGGGAATATTT
GACCAAAGCAGGGTATTACGGGCGGTTAGATAAGGCCAAGCTCCCAACTGAATTTCCAGCCTTAGCCGCT
AAAACTGAAGACCCCATTAAACGTTGGCTATTCTCTTAA