SecReT6
Protein ID: 153949042
SecReT6 ID223
T6SS typei3
Gene symbol-
Locus tagYpsIP31758_1374
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]1613591..1616341 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA7FGH5
KEGG IDypi:YpsIP31758_1374
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.70E-76, Aligned region: 18..336
Phage_base_V [PF04717], Evalue: 4.00E-24, Aligned region: 376..469
Protein Sequence: 916 a.a.     [Download]
>gi|153949042|ref|YP_001400353.1| Rhs element Vgr protein [Yersinia pseudotuberculosis IP 31758]
MPYLLGEPALVLSKLEGEEAFSTLYSYTITAKTPANPLIPWQAASNVDLKSLIGKEMTIEMELDGNGLGD
VRSVGKGTREITGLVERARYIGRDANQAIFEITIKPWFYLANLTSDFKIYQNKNVVDIIEEVFSDYNFPF
EKRLATTYPILDFQVQYGETDFNFLQRLMEEWGIYWFFEHQDHKQKLILVDHVGAHKRSFSTAYHAIEYL
SDEPKAGEEYITQFQTQETLTSGTWVTNDYDFTKSRADILAMDSKPRKTSFNDLEIYHWPGDYDQPDIGE
HLSRVRIEERGALGSRAVGSGQLRGIVCGANFELKGFPVDKANREYMIISSRLTVAEVDQLSGGEDAFSC
ESSFTVQPTTKIYRHPQVTPKPKTNGPQNAIIVGPPGEEIWTDEYGRVKVRFVWDRYGTNSESDSCWLRV
SQAWAGNSFGGIYIPRIGQEVIVDCINGDPDRPMVMGSLYNNVTRPPWDLPANATQSGMVSRTVGGGLTN
YNGVRFEDKSGLEQYWEQAERDMSRLTKNNETQIIGADSVLNVGANRSEVVGANYNQDVLGTSMLAIGAA
SMLQVGLARSVVVGGAHSLNVVLANATNVGGANMTNVGGFNGLAVGGAHQTAVGGAATLAAGGPIAIGAG
GELILSGDIVKIVGKSKVIIQGGEVHINSDDCCGRKTGNGGGAFGAFASLAGLLPLAGAIALPLPLPVLP
IVVPPVTSPPDPTVPPDPTLPPDPTLPPDPTLPPDPTLPPETTAPPETTAPPETTAPPETTAPPETTAPP
ETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTA
PPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPEPTRTPPG
TQTPPP
 
Nucleotide Sequence: 2751 bp     [Download]
>gi|153946813|ref|NC_009708.1|:1613591-1616341 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGCCTTATCTATTGGGTGAGCCTGCGCTGGTACTGTCTAAGTTGGAAGGCGAGGAAGCTTTTTCGACTT
TATATTCTTATACTATTACGGCAAAGACACCGGCTAATCCATTAATTCCTTGGCAAGCGGCTTCAAATGT
CGATCTCAAATCCTTAATTGGTAAAGAGATGACGATTGAAATGGAACTGGACGGCAACGGCCTGGGTGAT
GTGAGAAGTGTAGGTAAAGGCACGCGTGAAATTACGGGGCTGGTTGAGAGAGCCAGATACATTGGTCGAG
ATGCCAATCAGGCCATATTTGAGATCACTATTAAGCCTTGGTTCTACCTGGCTAATTTAACCTCTGACTT
TAAAATTTATCAAAATAAAAATGTCGTTGATATTATAGAGGAAGTGTTCTCAGACTATAATTTTCCGTTT
GAGAAACGGTTGGCTACAACCTATCCGATATTAGATTTTCAGGTTCAGTACGGTGAAACCGACTTTAATT
TCCTTCAGCGTTTGATGGAAGAGTGGGGTATTTACTGGTTCTTTGAGCATCAGGATCATAAACAAAAATT
AATTCTTGTGGATCATGTCGGTGCGCATAAACGCTCGTTCAGTACCGCCTACCATGCCATTGAGTACTTG
TCAGATGAGCCTAAAGCGGGCGAAGAGTACATCACACAATTCCAGACTCAGGAAACCTTGACGAGTGGGA
CCTGGGTCACCAACGATTATGACTTCACGAAATCCCGTGCCGATATTCTGGCAATGGACAGTAAACCGCG
TAAAACCAGCTTTAACGATCTCGAGATTTATCACTGGCCAGGGGATTATGATCAGCCAGATATTGGTGAG
CACCTTTCACGCGTGCGTATCGAAGAACGTGGTGCTCTGGGTTCGCGGGCGGTCGGTTCTGGTCAACTGC
GCGGGATAGTTTGTGGTGCTAACTTCGAGCTGAAAGGGTTCCCCGTTGATAAAGCGAATCGGGAATACAT
GATTATCTCCAGCCGTTTGACGGTGGCTGAAGTTGATCAACTGTCTGGCGGTGAGGATGCGTTTAGTTGC
GAGAGTTCTTTCACGGTTCAGCCGACGACCAAAATCTATCGTCACCCACAGGTGACACCAAAACCGAAAA
CCAATGGGCCGCAAAACGCCATTATTGTGGGGCCACCGGGTGAAGAGATTTGGACCGATGAATATGGCCG
CGTAAAAGTGCGTTTCGTTTGGGATCGCTATGGCACAAACAGCGAGTCAGACTCTTGCTGGCTACGTGTT
AGCCAGGCTTGGGCAGGTAACAGCTTTGGTGGGATCTATATTCCACGCATTGGTCAGGAAGTCATTGTTG
ACTGTATTAACGGCGATCCTGACCGGCCAATGGTGATGGGCAGCCTTTATAATAATGTGACGCGTCCCCC
TTGGGACCTGCCTGCCAATGCGACGCAAAGTGGCATGGTCAGTCGTACTGTTGGCGGCGGGTTAACCAAC
TATAACGGCGTTCGTTTTGAAGATAAATCGGGGCTGGAGCAGTACTGGGAACAGGCCGAGCGCGATATGT
CGCGTTTGACTAAAAATAATGAAACGCAAATTATCGGTGCCGATTCGGTCCTGAATGTTGGGGCCAACCG
AAGTGAAGTTGTCGGGGCCAATTATAACCAAGATGTTCTTGGCACATCAATGTTAGCCATCGGTGCTGCC
TCTATGCTACAGGTGGGATTGGCGCGTAGCGTTGTGGTTGGCGGAGCACATTCACTGAATGTGGTTTTGG
CGAATGCCACCAATGTGGGTGGCGCTAACATGACCAACGTAGGGGGGTTTAATGGCCTTGCGGTGGGGGG
AGCCCATCAGACAGCTGTAGGCGGTGCTGCGACACTGGCTGCCGGCGGCCCTATTGCTATTGGGGCGGGT
GGTGAGCTTATCCTCAGTGGGGATATCGTAAAAATTGTTGGTAAAAGTAAGGTTATTATTCAGGGCGGTG
AAGTTCACATTAACTCTGATGATTGTTGTGGTCGTAAAACGGGCAATGGCGGCGGGGCATTCGGTGCCTT
TGCGAGCCTGGCAGGTTTATTGCCGCTGGCGGGTGCTATTGCCTTACCGCTACCGTTACCCGTGTTGCCA
ATAGTGGTGCCACCAGTGACATCGCCACCGGATCCAACAGTGCCACCGGATCCGACATTGCCACCGGATC
CGACATTGCCACCAGATCCAACGTTGCCACCAGATCCAACGTTACCGCCGGAAACCACGGCACCGCCGGA
AACCACGGCACCGCCAGAAACCACGGCACCGCCGGAAACCACGGCACCGCCGGAAACCACGGCACCGCCG
GAAACCACGGCACCGCCGGAAACAACGGCACCGCCGGAAACAACGGCACCGCCGGAAACAACGGCACCGC
CAGAGACAACGGCACCGCCAGAGACAACGGCACCGCCGGAAACAACGGCACCGCCGGAAACAACGGCACC
GCCGGAAACAACGGCACCGCCAGAGACAACGGCACCGCCGGAAACAACGGCACCGCCAGAGACAACGGCA
CCGCCGGAAACAACGGCACCGCCAGAGACAACGGCACCGCCGGAAACAACGGCACCGCCAGAGACAACGG
CACCGCCAGAGACAACGGCACCGCCGGAAACAACGGCACCGCCAGAAACAACGGCACCGCCGGAAACAAC
GGCACCGCCGGAAACAACGGCACCGCCAGAAACAACGGCACCGCCGGAACCGACGCGAACACCGCCAGGG
ACGCAGACGCCACCGCCTTGA