SecReT6
Protein ID: 153949179
SecReT6 ID222
T6SS typei2
Gene symbol-
Locus tagYpsIP31758_0796
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]958005..959609 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDA7FEV2
KEGG IDypi:YpsIP31758_0796
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.60E-21, Aligned region: 68..126
ImpA-rel_N [PF06812], Evalue: 3.60E-21, Aligned region: 157..177
ImpA-rel_N [PF06812], Evalue: 3.60E-21, Aligned region: 302..315
ImpA-rel_N [PF06812], Evalue: 3.60E-21, Aligned region: 354..364
Protein Sequence: 534 a.a.     [Download]
>gi|153949179|ref|YP_001399780.1| ImpA domain-containing protein [Yersinia pseudotuberculosis IP 31758]
MATLNTLITACAAVPDSLLLKAEQQVTLWDRWLQPVTTEQHSGEDLSYNDDFQQMREEVNKLSGADTTLA
SELAEKLLTLHGKDVRVATYYIWARLHRDGEAGLADGLALLAGLISRFGETLHPLRAASRKTALEWLSSS
RVLDSLSLYPEVDNADFERIVGALALIEQSLSGWDDASRPQFGGLYLALEHRLAQSGGPNAVVPQNSSGS
SSAGSQGQTAMVSPELRPVQSGRDLLDQAKTLAKYLRNQPQGWLSGHHLIKSVRWDTVHQSPPLDVSGRT
RLVPPRPEYRVLLKRLYLQQNWLELLEQAESIFAEGVNHFWLDVQWYLHQALSKAGAPFDGWAACITQDL
RLLLTRLPGLEGLCWSDGTPFADEVTLGWINQQVLESVSGWGSEPAAVMASGEDDILLLEPEALAQADSE
GIEAALNWLQSRPGITTARHQWLLRLVMARVAEQYGKNDMALHLLSELDSRGALLTLPQWEPGLAFEVKA
RSLKLLRMKAQRSDSEKTRLHIEMESLLSGLMALDPARAAVLCG
 
Nucleotide Sequence: 1605 bp     [Download]
>gi|153946813|ref|NC_009708.1|:958005-959609 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGGCGACGTTAAATACCCTGATCACTGCCTGTGCCGCTGTCCCTGATTCACTGTTATTAAAGGCAGAAC
AACAGGTTACACTTTGGGATCGCTGGTTGCAGCCGGTGACGACTGAACAGCACAGCGGAGAAGACCTCAG
TTACAATGATGACTTCCAGCAGATGCGTGAAGAGGTCAATAAGCTCTCGGGTGCTGATACCACGTTAGCC
AGCGAGCTGGCAGAAAAACTGTTAACCCTGCATGGCAAAGATGTGCGGGTGGCAACCTATTACATTTGGG
CGCGTTTACACCGTGATGGCGAGGCTGGGCTGGCGGATGGACTGGCACTGCTGGCCGGGCTTATCAGCCG
TTTTGGTGAAACCCTGCATCCGTTGCGCGCAGCCAGTCGGAAAACTGCGCTGGAATGGCTATCGAGTTCT
CGCGTGCTGGACAGTTTGTCGCTCTATCCTGAAGTGGATAATGCGGATTTTGAACGCATCGTTGGCGCAC
TGGCGTTAATCGAACAGAGCCTCAGCGGCTGGGATGACGCATCCCGTCCGCAGTTTGGTGGATTGTATCT
TGCCTTGGAACATCGTCTGGCGCAGTCCGGTGGACCGAATGCGGTGGTGCCACAAAACAGCAGCGGGTCA
TCATCGGCAGGGAGTCAGGGCCAGACGGCTATGGTTTCACCGGAGTTGCGGCCAGTCCAGTCGGGGCGTG
ACCTGCTCGACCAGGCTAAAACGTTAGCAAAATACCTGCGGAACCAGCCGCAGGGATGGCTCTCCGGGCA
TCATCTTATCAAGAGCGTGCGCTGGGATACGGTACACCAGTCACCGCCGTTGGATGTGAGTGGACGAACC
CGACTGGTACCGCCGCGCCCGGAATATCGCGTGCTGCTTAAGCGTCTTTATCTGCAACAAAACTGGCTGG
AGTTGTTGGAACAGGCGGAATCGATATTTGCCGAAGGGGTCAACCATTTCTGGCTCGATGTGCAGTGGTA
TCTGCATCAGGCACTCAGTAAAGCGGGAGCCCCATTCGATGGCTGGGCAGCTTGTATCACCCAGGATTTA
CGTCTGTTACTGACCCGGCTGCCCGGTCTGGAGGGGCTATGCTGGAGTGACGGCACGCCGTTTGCCGATG
AGGTGACGCTGGGGTGGATAAACCAGCAGGTGCTGGAGTCGGTGTCGGGCTGGGGCAGCGAGCCTGCCGC
CGTGATGGCATCGGGCGAAGATGACATTCTGTTGCTGGAGCCAGAAGCTCTGGCTCAGGCGGACAGTGAA
GGGATTGAAGCCGCACTTAACTGGTTGCAATCCCGTCCGGGTATTACCACTGCCCGCCATCAGTGGCTGC
TGCGTTTGGTGATGGCCCGCGTGGCGGAGCAGTACGGCAAGAACGATATGGCACTGCATCTGCTTAGTGA
ACTTGATAGCCGCGGTGCATTGCTAACCTTGCCGCAGTGGGAGCCGGGGCTGGCGTTTGAAGTCAAAGCC
CGAAGTCTGAAGCTGCTGCGGATGAAAGCACAACGCAGCGACAGTGAAAAAACCCGCCTGCATATCGAAA
TGGAAAGCTTGCTCAGTGGGCTTATGGCCCTCGACCCGGCCCGTGCGGCCGTATTATGCGGATAA