SecReT6
Protein ID: 153949195
SecReT6 ID220
T6SS typei1
Gene symbol-
Locus tagYpsIP31758_0339
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]397578..399776 [+]
ProductVgrG protein
NoteTssI
UniProt IDA7FDK5
KEGG IDypi:YpsIP31758_0339
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.50E-70, Aligned region: 134..431
Phage_base_V [PF04717], Evalue: 1.40E-23, Aligned region: 471..563
Gp5_C [PF06715], Evalue: 1.50E-05, Aligned region: 605..628
Gp5_C [PF06715], Evalue: 1.50E-05, Aligned region: 630..654
Protein Sequence: 732 a.a.     [Download]
>gi|153949195|ref|YP_001399333.1| VgrG protein [Yersinia pseudotuberculosis IP 31758]
MFAHDKANNNKAADKTGAVTPTHIVSPEAAPTVSGAQMTGMAGGIGDAVGGTAGKRISQAAEVAKTALDA
KAKVLDAGVKPMSVAASGAGVALPDSAAAALTRLVKQPSGLQFTLTAASLPPQTFAVVDFTLSEMLSSPF
VLNVGLASADPAVDFAAVLDEDATLFIWREGVLQRSITGMVASFEQGDTGFHQTRYSMVIRPALWRTSLR
RNARIFQQASVEEIITTLLKENGINDFAFGFRHPHPVREFCVQYQESDFDFIQRLTAEEGIFYYFEFSAG
KNTVVYADDVGSLPKGASLPYNPNVAAQAQELSITTFTRSAQVRPAMVQLKDYTFKNPNWAAAFSEQSGE
LQNQRPDYEHFDFPGRFKDAQHGQDFTRYRLDALRNDANLGQGASNDFTLQPGQLFSLYNHPRGDLNHAW
QLLGIQHSGKQMQALEQASGDQGTVLFNHFSFIPHTQTWRPTPLAKPAMDGPQIAMVVGPPGEEIYCDEY
GRIRLQFLWDRYGQSNDNSSCWIRVTQPWAGQGWGMLAIPRIGQEVVVDFLHGDPDQPIVTGRTYHANNI
PPGSLPASKTQMAFRSKTHKGEGYNEMRFEDAKGGEGLFMHAQKDMSTTVKDNQTTTVEKGNQTVTVEKG
DRTVTVATGNETTDITQGSLTETIKVRRSTCANFIQVKAEGDAPGTQLYTATEQIKFVVGKSSITLNPDS
IILQFSGSTSITLNAANIDAIAPLINLNKDKG
 
Nucleotide Sequence: 2199 bp     [Download]
>gi|153946813|ref|NC_009708.1|:397578-399776 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGTTTGCTCATGATAAAGCTAATAATAATAAAGCCGCGGACAAGACCGGCGCAGTGACGCCGACCCATA
TCGTCTCGCCGGAGGCCGCCCCAACCGTGAGTGGCGCTCAGATGACCGGGATGGCCGGGGGGATCGGGGA
TGCGGTGGGCGGCACTGCCGGTAAGCGCATCAGTCAGGCTGCCGAGGTGGCTAAAACCGCCCTGGACGCC
AAGGCAAAAGTACTGGACGCGGGTGTTAAACCGATGAGTGTGGCGGCAAGTGGCGCAGGAGTAGCATTAC
CGGACAGCGCCGCGGCGGCGCTTACCCGCCTGGTCAAACAGCCCTCCGGCCTGCAATTTACCCTGACGGC
GGCCAGTTTACCGCCCCAGACCTTTGCGGTGGTGGATTTCACCCTGAGCGAGATGCTCTCCTCGCCGTTT
GTGCTCAATGTCGGGCTGGCGAGTGCCGATCCGGCGGTGGATTTTGCGGCGGTATTGGATGAAGACGCCA
CGCTGTTTATCTGGCGCGAAGGGGTACTGCAACGCAGCATCACCGGCATGGTCGCCAGCTTTGAACAGGG
CGATACCGGTTTTCATCAGACCCGCTACAGCATGGTGATCCGCCCGGCGCTGTGGCGCACCAGCCTGCGG
CGCAATGCCCGCATCTTCCAGCAAGCCTCGGTGGAAGAGATCATCACCACCCTGCTGAAAGAGAACGGCA
TCAACGATTTTGCTTTTGGTTTTCGCCACCCGCACCCGGTGCGCGAGTTCTGCGTGCAATATCAGGAGTC
CGATTTTGATTTTATCCAGCGCCTGACGGCAGAAGAGGGGATTTTCTACTACTTCGAGTTCAGCGCCGGG
AAAAATACCGTGGTGTATGCCGATGATGTTGGCTCCCTGCCGAAAGGCGCGTCACTGCCCTATAACCCGA
ATGTGGCGGCGCAGGCGCAGGAACTGAGTATCACCACCTTCACCCGCAGTGCGCAGGTGCGCCCGGCGAT
GGTGCAACTGAAAGACTACACCTTTAAAAACCCGAACTGGGCCGCGGCCTTCAGCGAACAGTCGGGAGAA
CTGCAAAACCAGCGACCGGACTACGAGCATTTTGATTTTCCGGGGCGCTTCAAAGATGCCCAGCACGGGC
AGGATTTTACCCGTTACCGGCTGGACGCGCTGCGCAATGACGCCAATCTGGGGCAGGGGGCGAGCAATGA
TTTTACCCTCCAGCCGGGGCAGTTGTTCAGCCTGTACAACCACCCGCGTGGTGATCTGAACCACGCCTGG
CAGTTGCTCGGCATTCAGCACAGCGGTAAACAGATGCAGGCGCTGGAGCAGGCATCTGGCGATCAGGGCA
CGGTGCTGTTCAACCACTTCAGTTTTATTCCGCACACCCAGACCTGGCGGCCGACGCCGTTGGCTAAACC
GGCGATGGACGGCCCGCAGATCGCCATGGTGGTGGGGCCACCGGGGGAAGAGATTTACTGCGACGAATAC
GGCCGTATCCGCCTGCAATTTTTATGGGATCGCTACGGGCAGAGCAATGACAACAGCTCCTGCTGGATCC
GGGTGACCCAGCCGTGGGCGGGCCAGGGCTGGGGCATGCTGGCCATTCCGCGTATTGGTCAGGAAGTGGT
GGTGGATTTTCTGCACGGCGATCCGGATCAACCGATTGTCACGGGGCGGACCTATCACGCCAACAACATC
CCGCCGGGGTCGTTACCGGCCAGTAAAACCCAGATGGCGTTCCGCTCAAAAACCCACAAAGGGGAAGGCT
ACAACGAAATGCGCTTCGAGGATGCCAAAGGCGGCGAAGGGCTGTTTATGCATGCGCAGAAAGATATGAG
TACCACGGTAAAAGATAACCAGACGACGACGGTGGAGAAAGGTAATCAAACCGTCACCGTGGAAAAAGGT
GACAGGACAGTCACGGTCGCGACCGGAAATGAAACCACAGATATTACCCAAGGGAGCCTGACCGAGACGA
TCAAAGTGCGTCGCAGTACCTGCGCGAATTTTATTCAGGTGAAGGCTGAAGGTGATGCGCCTGGTACGCA
ACTTTATACCGCGACGGAACAGATAAAGTTCGTGGTGGGCAAGAGCAGCATTACCTTAAATCCGGACTCT
ATTATTCTGCAATTTTCTGGCTCTACCTCTATTACGCTGAATGCCGCCAATATTGACGCCATCGCGCCAT
TGATTAACTTAAATAAAGACAAGGGATAA