SecReT6
Protein ID: 153949263
SecReT6 ID224
T6SS typei2
Gene symbol-
Locus tagYpsIP31758_2508
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]2840772..2841458 [-]
Producthypothetical protein
NoteTssL
UniProt IDA7FJP8
KEGG IDypi:YpsIP31758_2508
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.90E-45, Aligned region: 17..216
Protein Sequence: 228 a.a.     [Download]
>gi|153949263|ref|YP_001401476.1| hypothetical protein YpsIP31758_2508 [Yersinia pseudotuberculosis IP 31758]
MNPHLTEHPPVGDIDVLLQDTWLQVISLRQGVTCAEGEGQAFWQRCVADIERVHQALKDAGHSEQSCQHI
RYAQCALLDETVKGRGVQDDAYFVWCHSPLQAHFFNTLDAGSQLYEQMRAVLREPAPDSAVLTCFHRVLM
LGFLGGYASPAASEREQLIDQLSVQVPAFSVAPSGGILASAASRNRLGIWLRYWPVRLGLAALMVALLWW
GLDHWLSGLLTTLLPEPV
 
Nucleotide Sequence: 687 bp     [Download]
>gi|153946813|ref|NC_009708.1|:c2841458-2840772 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGAATCCTCACCTAACCGAACACCCCCCAGTCGGGGATATTGACGTCCTGTTGCAGGACACCTGGCTAC
AGGTGATCAGCCTGCGTCAAGGGGTAACCTGTGCCGAGGGCGAAGGGCAGGCATTCTGGCAGCGCTGTGT
GGCGGACATTGAACGTGTCCATCAGGCGCTGAAAGACGCCGGTCACAGCGAGCAGAGTTGCCAGCACATC
CGATACGCCCAATGTGCACTGCTGGATGAGACCGTGAAAGGGCGCGGTGTACAGGATGACGCCTACTTCG
TGTGGTGCCATTCGCCCTTACAGGCGCATTTTTTCAATACCCTGGATGCCGGGAGCCAGTTGTACGAGCA
GATGCGCGCCGTGTTGCGTGAACCTGCGCCGGACAGCGCGGTACTGACCTGTTTTCACCGGGTATTGATG
TTGGGCTTCCTCGGCGGGTACGCCTCCCCGGCGGCTTCTGAACGGGAGCAACTGATCGATCAACTGAGCG
TGCAGGTACCGGCGTTCAGTGTCGCGCCATCCGGTGGGATCCTGGCAAGCGCCGCCTCCCGCAACCGGTT
GGGGATCTGGCTGCGTTACTGGCCGGTACGGCTCGGGCTGGCTGCGCTGATGGTCGCGCTGTTGTGGTGG
GGCCTTGATCACTGGCTGTCCGGTCTGTTAACCACCTTACTGCCGGAGCCGGTGTAA