SecReT6
Protein ID: 153949284
SecReT6 ID220
T6SS typei1
Gene symbol-
Locus tagYpsIP31758_0315
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]364996..365436 [+]
Producthypothetical protein
NoteTssE
UniProt IDA7FDI1
KEGG IDypi:YpsIP31758_0315
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.10E-19, Aligned region: 32..122
Protein Sequence: 146 a.a.     [Download]
>gi|153949284|ref|YP_001399309.1| hypothetical protein YpsIP31758_0315 [Yersinia pseudotuberculosis IP 31758]
MAALLNWDRGSSASLFDRIQGKGASSSSDGRLRELLNSIQKHLNEVLNSRPGACQSAVDLGVIDLNDATA
TSSDFRKSIEKAIKDCIENYEPRISAVTVQSLLNHGDPLQLSFHISARVNFDDMGDVVEFNIQLDNNRRY
CFNQET
 
Nucleotide Sequence: 441 bp     [Download]
>gi|153946813|ref|NC_009708.1|:364996-365436 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGGCCGCGCTTCTTAATTGGGATCGAGGGAGTTCTGCCAGTTTGTTTGACCGCATACAGGGGAAGGGCG
CTAGCTCTTCCTCCGATGGCCGTCTGCGTGAGCTATTGAATTCAATCCAAAAGCATTTGAACGAGGTCCT
TAACTCTCGTCCAGGTGCTTGTCAAAGTGCGGTCGATCTCGGGGTTATCGACCTCAATGATGCGACCGCC
ACCTCATCTGATTTTCGAAAAAGTATTGAGAAAGCCATTAAGGATTGTATCGAGAACTACGAACCCCGAA
TTTCTGCCGTTACGGTTCAATCCTTGCTGAACCATGGCGACCCACTGCAACTGAGTTTCCATATTAGCGC
TCGTGTTAATTTCGACGATATGGGTGATGTCGTTGAGTTCAACATTCAGTTAGACAATAACCGCCGTTAC
TGCTTTAACCAGGAAACATAA