SecReT6
Protein ID: 153949312
SecReT6 ID222
T6SS typei2
Gene symbol-
Locus tagYpsIP31758_0779
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]935078..936430 [+]
Producthypothetical protein
NoteTssK
UniProt IDA7FET6
KEGG IDypi:YpsIP31758_0779
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.20E-133, Aligned region: 18..447
Protein Sequence: 450 a.a.     [Download]
>gi|153949312|ref|YP_001399764.1| hypothetical protein YpsIP31758_0779 [Yersinia pseudotuberculosis IP 31758]
MKIERPLWTRGVLISPQQFQQQASWEAWTNECIAQMGVMHPWGVLQATFALDALAQGRLKAERLHLRFQD
GVLVDTDCADVLPPTLTLAANLPPEATEATVMLAMPQLYANGGNCLQPDERGERPVRHRQAWRDVQNQYG
DDKKQVAVMYHQLTLRLDSQENGDYQVCPVARLLRDAQGRWTLDPRFIPPMLSLQASAWCGEQLELLMVQ
LRARLQRLMGMRRESNARMADFAVADVSLFWLLNALNSAEPVLGNFQRYPQTHPERLYQELARLAGSLLT
FSLEHEVTAIPVYQHEQLTRVFPPLFALLNILLEASLPSRVVAIELEHEPRINQWRATLRDPRLREGADF
YLSVRSTLSSAQLQTQFPQLCKAGAPDDVGNVVNVALSGIPLRPLSHVPAAIPLRLENQYFSLDLSHPAA
KQMMEAGACVFYVPGTLGEIQLELFAVLRA
 
Nucleotide Sequence: 1353 bp     [Download]
>gi|153946813|ref|NC_009708.1|:935078-936430 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGAAGATTGAACGTCCTCTGTGGACTCGCGGAGTTTTGATTTCCCCGCAGCAATTTCAACAACAGGCTT
CTTGGGAGGCCTGGACCAATGAATGCATCGCACAAATGGGCGTCATGCATCCCTGGGGAGTCCTTCAGGC
CACTTTTGCATTAGATGCATTGGCTCAGGGCCGCCTGAAAGCAGAACGTTTGCACCTTCGTTTTCAGGAC
GGTGTCTTGGTGGACACCGATTGTGCTGATGTGTTGCCCCCGACACTGACACTGGCCGCGAATCTGCCGC
CGGAGGCCACCGAAGCCACGGTTATGCTGGCGATGCCACAACTGTATGCCAACGGGGGTAACTGCCTGCA
ACCCGATGAGCGGGGCGAACGGCCCGTGCGCCATCGTCAGGCTTGGCGCGATGTACAAAATCAGTATGGG
GATGATAAAAAGCAGGTCGCGGTGATGTACCACCAACTGACCCTGCGGTTGGACAGTCAGGAAAACGGCG
ATTATCAGGTCTGTCCGGTGGCGCGTTTGCTGCGGGATGCGCAAGGTCGCTGGACACTGGATCCACGTTT
TATCCCGCCTATGCTGAGCTTGCAGGCCAGTGCCTGGTGTGGCGAACAGCTGGAATTACTGATGGTGCAG
CTTCGGGCGCGTTTACAGCGTCTGATGGGCATGCGCCGGGAAAGCAATGCACGAATGGCTGATTTTGCTG
TCGCGGATGTGTCGTTATTCTGGTTGCTCAATGCCCTTAACAGCGCTGAGCCGGTACTGGGGAATTTTCA
GCGTTATCCGCAGACCCACCCGGAACGGCTGTATCAGGAACTGGCAAGATTGGCGGGCAGCCTGCTGACG
TTTTCCCTTGAGCATGAAGTGACGGCGATCCCGGTTTATCAGCATGAACAGCTGACCCGCGTCTTCCCCC
CTTTATTTGCTTTGCTGAATATTCTGCTGGAAGCCAGCCTCCCTTCACGGGTGGTGGCGATTGAGCTGGA
GCATGAACCGCGTATCAATCAGTGGCGAGCGACCCTGCGTGATCCTCGCTTGCGTGAGGGGGCCGATTTC
TATCTGTCGGTACGTTCCACGCTGTCTTCAGCGCAGTTACAAACCCAGTTCCCGCAGTTGTGTAAAGCCG
GAGCGCCGGATGATGTCGGTAATGTGGTGAATGTCGCACTGAGCGGGATCCCGTTGCGTCCACTGAGCCA
TGTCCCTGCCGCCATCCCCTTGCGCCTGGAAAATCAGTATTTCTCCCTTGATCTCAGCCACCCTGCTGCG
AAGCAGATGATGGAGGCAGGGGCTTGTGTGTTCTATGTGCCTGGTACGCTGGGTGAGATCCAACTGGAAT
TGTTTGCGGTGTTGCGCGCATGA