SecReT6
Protein ID: 153949732
SecReT6 ID223
T6SS typei3
Gene symbol-
Locus tagYpsIP31758_1359
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]1590210..1591403 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDA7FGG0
KEGG IDypi:YpsIP31758_1359
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.80E-18, Aligned region: 62..121
ImpA-rel_N [PF06812], Evalue: 3.80E-18, Aligned region: 203..215
Protein Sequence: 397 a.a.     [Download]
>gi|153949732|ref|YP_001400338.1| ImpA domain-containing protein [Yersinia pseudotuberculosis IP 31758]
MSEQSIAERAGYYQSMMQPIPGDFPCGKNLEYDPAFIMLQTKLQPKQAAEYGNFVEVAEPNNWTDIERKC
LELLNNSRDIRLFIILMRCRMRQVGVGALQEGLEAILWCLDTWPDQLHPQLFDEGEFEPLMRGNAFAELE
DIDGFIADFRNQQLPKAAGVQLSIKEFEKAHSVPREEGALDEGTLEAVKQEWQNRSDHTILSLQHAYALL
QGLATRLNNSLGEDTPDFVRMTSVLRHFDAAITPIAPIVVPEPIETPDVVELYPVATAMLASTEMPVTAE
VQTVAETQMAIPIEAPQQRQAVVTPSPPLQPLQLQSAQLQPVPIQSPPVPVQQQGIQNRADALARLIEVR
EWFTAMEPSSPVIALLAFSEKTIGKSFGELLQFIPQELISKLNEGQE
 
Nucleotide Sequence: 1194 bp     [Download]
>gi|153946813|ref|NC_009708.1|:c1591403-1590210 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGAGTGAACAGAGTATCGCTGAACGTGCCGGTTATTATCAAAGCATGATGCAGCCCATTCCAGGTGACT
TTCCTTGTGGCAAAAATCTGGAATATGACCCGGCATTTATTATGCTACAGACAAAATTGCAGCCTAAGCA
GGCCGCTGAATACGGCAATTTTGTTGAGGTCGCTGAACCTAATAACTGGACAGATATCGAGCGTAAATGC
CTTGAACTCCTGAATAATTCTCGGGATATTCGGCTGTTTATTATTCTGATGCGCTGCCGGATGCGTCAGG
TCGGTGTGGGCGCGTTGCAAGAAGGGCTGGAAGCCATACTTTGGTGCCTCGACACTTGGCCTGATCAGCT
ACATCCTCAGCTGTTTGATGAAGGGGAATTTGAACCTTTAATGCGCGGTAATGCTTTTGCTGAACTGGAA
GACATTGATGGTTTTATCGCCGACTTCCGTAATCAGCAGTTACCCAAAGCCGCTGGCGTGCAACTTTCCA
TCAAAGAGTTTGAAAAGGCACACTCCGTTCCTCGAGAAGAAGGGGCATTGGACGAAGGGACTCTGGAAGC
CGTCAAGCAAGAGTGGCAGAACCGATCAGATCACACCATTCTTTCACTCCAGCACGCTTATGCCTTGTTG
CAAGGATTAGCCACGCGCCTCAACAACTCCCTCGGTGAAGACACACCTGATTTTGTCAGAATGACCTCGG
TGTTACGCCACTTTGATGCCGCGATAACCCCGATAGCGCCTATCGTGGTGCCAGAACCTATTGAGACCCC
AGACGTTGTCGAGCTCTATCCGGTCGCCACAGCGATGCTAGCAAGCACAGAAATGCCAGTGACCGCCGAG
GTACAGACGGTTGCAGAGACACAAATGGCCATACCCATTGAGGCTCCCCAACAGCGTCAAGCGGTGGTAA
CCCCATCCCCGCCGTTGCAGCCGTTACAGTTGCAATCGGCACAGTTGCAACCTGTACCGATACAGTCGCC
GCCGGTGCCTGTCCAACAGCAGGGGATCCAAAACAGGGCTGATGCGTTAGCCCGGCTTATAGAGGTGCGA
GAGTGGTTTACCGCCATGGAACCGAGTAGCCCGGTCATTGCCTTACTGGCTTTTTCAGAAAAAACTATCG
GCAAAAGCTTCGGCGAATTGCTGCAGTTCATTCCTCAGGAACTGATTTCGAAACTCAATGAAGGACAGGA
GTAA