SecReT6
Protein ID: 153949766
SecReT6 ID222
T6SS typei2
Gene symbol-
Locus tagYpsIP31758_0778
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]933399..934952 [+]
Producthypothetical protein
NoteTssC
UniProt IDA7FET5
KEGG IDypi:YpsIP31758_0778
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.20E-177, Aligned region: 26..54
DUF877 [PF05943], Evalue: 2.20E-177, Aligned region: 93..513
Protein Sequence: 517 a.a.     [Download]
>gi|153949766|ref|YP_001399763.1| hypothetical protein YpsIP31758_0778 [Yersinia pseudotuberculosis IP 31758]
MLMSVQENSAQGSATTVLEKNPAVAQGVYASLFEKINLNPVSSLAGLDAFQNSDALAEATTDERVTAAVS
VFLDLLKQSSKKVEKLDKTLLDGHIAALDDQISRQLDAVMHHADFQRVESTWRGVKSLIDQTDFRQNVRI
ELLDISKDHLVQDFEDAPEIVQSGLYTQTYIQEYDTPGGEPIAAAISNYEFDRSPQDIALLRNISKVAAA
AHMPFIGSVGPEFFGKENMEEVAAIKDIANYFDRAEYIKWKAFRDSDDSRYIGLTMPRVLGRLPYGPDTV
PVRSFNYVEQVKGPDHDRYLWTNASFAFAANMVKSFIKNGWCVQIRGPQAGGAVTNLPIHLYDLGTGNQV
KIPSEVMIPETREFEFANLGFIPLSYYKNRDYSCFFSANSAQKPALYDTADATANSRINARLPYIFLLSR
IAHYLKLIQRENIGTTKDRRLLELELNNWIRGLVTEMTDPGDDLQASHPLRDAKVTVEDIEDNPGFFRVK
LYAVPHFQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1554 bp     [Download]
>gi|153946813|ref|NC_009708.1|:933399-934952 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGCTGATGTCTGTACAGGAAAACAGTGCGCAGGGTAGTGCGACGACCGTGCTAGAGAAGAACCCTGCCG
TAGCTCAAGGGGTTTATGCCTCTTTATTTGAAAAGATCAACCTGAATCCCGTCTCCTCATTGGCTGGCCT
TGACGCTTTCCAGAACAGTGATGCACTGGCGGAAGCGACTACGGATGAGCGCGTTACCGCCGCCGTCAGT
GTCTTTTTAGACCTGCTGAAGCAATCGTCAAAAAAAGTGGAGAAGCTGGATAAAACCTTGCTGGATGGTC
ACATTGCGGCACTGGATGACCAAATCAGTCGCCAGTTGGATGCGGTGATGCATCACGCTGATTTTCAACG
TGTCGAGTCCACGTGGCGTGGTGTAAAATCCCTTATTGATCAAACCGACTTCCGTCAAAATGTCCGTATT
GAACTGCTGGATATCAGCAAGGATCATCTGGTACAGGATTTTGAAGACGCCCCTGAAATCGTGCAAAGCG
GTCTCTACACCCAGACCTACATTCAGGAATACGATACTCCCGGTGGCGAGCCAATTGCCGCGGCTATCTC
CAACTACGAGTTTGACCGCAGCCCGCAAGATATCGCCTTGTTGCGCAATATCTCCAAGGTGGCGGCGGCG
GCTCACATGCCATTTATCGGTTCTGTTGGTCCTGAGTTCTTTGGCAAAGAGAACATGGAAGAAGTGGCGG
CCATCAAAGATATCGCTAACTACTTTGACCGTGCCGAATACATCAAGTGGAAAGCTTTCCGCGACTCGGA
TGATTCCCGCTATATCGGCTTGACCATGCCGCGCGTGCTGGGGCGTTTGCCGTACGGGCCAGACACTGTG
CCAGTGCGTAGCTTCAACTACGTTGAGCAGGTGAAAGGGCCAGACCATGATCGCTATTTGTGGACCAATG
CCTCGTTTGCCTTTGCTGCCAACATGGTGAAAAGCTTCATTAAAAATGGCTGGTGCGTACAGATCCGTGG
GCCACAAGCCGGTGGTGCAGTGACCAATCTGCCAATCCACCTGTATGACTTGGGTACCGGTAATCAGGTC
AAAATCCCGTCAGAAGTGATGATCCCGGAAACGCGCGAATTTGAGTTTGCCAACCTGGGCTTTATCCCGC
TGTCATACTACAAAAACCGTGATTACTCGTGCTTCTTCTCGGCTAACTCCGCCCAGAAACCGGCGCTGTA
TGATACCGCCGATGCCACCGCCAACAGTCGCATCAATGCCCGTCTGCCGTATATCTTCCTGCTGTCACGC
ATTGCCCATTACCTGAAGTTGATTCAGCGTGAAAACATTGGCACCACCAAAGATCGTCGTTTGCTGGAGC
TGGAGCTGAATAACTGGATCCGTGGGCTAGTCACTGAAATGACTGATCCGGGTGATGATTTACAGGCATC
CCATCCACTGCGTGATGCGAAAGTCACGGTAGAAGATATCGAAGACAACCCCGGCTTCTTCCGCGTCAAG
CTGTATGCCGTGCCACATTTCCAGGTGGAAGGCATGGATGTGAATTTGTCATTGGTTTCCCAGATGCCGA
AGGCGAAAGCCTGA