SecReT6
Protein ID: 153949967
SecReT6 ID223
T6SS typei3
Gene symbol-
Locus tagYpsIP31758_1372
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]1608052..1609428 [+]
ProductOmpA domain-containing protein
NoteTssL
UniProt IDA7FGH3
KEGG IDypi:YpsIP31758_1372
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.20E-54, Aligned region: 86..291
OmpA [PF00691], Evalue: 3.20E-16, Aligned region: 352..450
Protein Sequence: 458 a.a.     [Download]
>gi|153949967|ref|YP_001400351.1| OmpA domain-containing protein [Yersinia pseudotuberculosis IP 31758]
MSDSSDLNLGGSMPPFDQSRNVDESPQALGRFLLDEPITYPDSTQDNAAFTREAPHSGAAQQYDTTLLRG
ESVQQRVAKVLASSTPLLEAAQPLLRALSEMPAHIGDVSQVHILKQSLKNEITLFSVVCDEADISWKKMA
IVRYCLCTALDEAAHTMSWGMMAGWSQSNLLNHFEGDNDGGNKFFLLVGRLSMSPHEYADGLEVLLRILG
LGFEGRYSIIEDGDRQLTKIRQGLLTLLQSTRDTIPPALSPHGLIAHQNRRRRGIFVPVRVSMLLCGFLI
VATFIGCKYFLSVPESDLLKRMAALQRVVVTPPVAAPKLRLSILLKDEIAKQLVSVDETSNNSKVIFKGD
SMFMVGSDNVRPEMIDVIKRVAQEVHRVKGAILIVGHTDSMPINKPGFPNNQVLSEKRAANVARYMEQAG
IPTDKIRFEGKGETQPVSSNDDATGRSQNRRVEIFVNY
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|153946813|ref|NC_009708.1|:1608052-1609428 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGAGTGACAGCAGTGATTTGAACCTTGGGGGCTCAATGCCTCCTTTTGATCAAAGCAGAAATGTGGATG
AGAGTCCGCAGGCATTAGGCCGGTTCTTGCTTGATGAACCAATAACATACCCAGATAGCACTCAGGATAA
TGCGGCCTTCACTAGAGAGGCCCCTCATTCTGGTGCGGCACAGCAATATGACACGACCCTCTTACGGGGT
GAAAGTGTGCAACAGCGTGTCGCTAAAGTACTCGCATCTTCAACGCCATTATTGGAAGCGGCACAGCCAC
TATTACGTGCCTTGAGCGAGATGCCCGCGCATATTGGGGATGTTTCACAGGTTCATATATTAAAACAAAG
CCTTAAAAATGAGATCACCCTCTTTAGTGTGGTGTGTGATGAAGCGGATATCTCATGGAAAAAAATGGCT
ATCGTCCGCTATTGCCTGTGTACTGCGTTGGATGAAGCCGCTCACACGATGTCGTGGGGAATGATGGCAG
GTTGGTCACAAAGCAACCTGTTGAACCATTTTGAAGGCGATAATGACGGCGGGAATAAGTTTTTCTTATT
GGTCGGCCGTCTCTCTATGAGCCCGCATGAATATGCGGATGGTTTAGAGGTTTTGCTGCGCATTTTAGGG
CTCGGTTTTGAGGGGCGCTACAGCATTATCGAAGATGGTGATCGGCAATTAACTAAAATACGCCAAGGGT
TGCTGACGCTGCTCCAAAGTACCCGAGACACGATCCCACCGGCACTTTCTCCGCATGGGTTGATCGCACA
TCAAAACAGAAGACGGCGGGGCATTTTTGTTCCGGTGCGCGTATCCATGCTGTTGTGTGGTTTCCTCATT
GTCGCGACCTTTATTGGATGTAAATACTTTCTCTCGGTACCGGAAAGTGACTTGCTAAAAAGAATGGCAG
CATTGCAACGTGTGGTTGTGACGCCACCCGTTGCCGCACCAAAACTTCGACTGTCTATTTTATTAAAAGA
TGAGATAGCGAAGCAGTTAGTCAGTGTTGATGAAACGAGCAACAACAGCAAAGTCATCTTTAAAGGCGAC
TCTATGTTTATGGTCGGCTCGGATAACGTCAGACCTGAAATGATTGACGTAATTAAACGCGTCGCGCAGG
AAGTGCATCGCGTTAAAGGGGCAATCCTCATTGTCGGGCATACAGACTCTATGCCGATTAATAAACCCGG
CTTCCCTAATAACCAGGTACTTTCCGAAAAACGCGCGGCCAATGTTGCACGCTATATGGAACAGGCCGGT
ATTCCAACCGACAAAATTCGGTTTGAGGGCAAGGGGGAAACGCAACCGGTTAGCAGCAATGACGATGCGA
CAGGACGTTCGCAAAACCGCCGCGTAGAAATTTTTGTTAATTATTGA