SecReT6
Protein ID: 153950286
SecReT6 ID222
T6SS typei2
Gene symbol-
Locus tagYpsIP31758_0802
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]964187..964768 [+]
Producthypothetical protein
NoteTssJ
UniProt IDA7FEV8
KEGG IDypi:YpsIP31758_0802
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 5.00E-38, Aligned region: 31..186
Protein Sequence: 193 a.a.     [Download]
>gi|153950286|ref|YP_001399786.1| hypothetical protein YpsIP31758_0802 [Yersinia pseudotuberculosis IP 31758]
MLAITSKNKICTSKNKTWAAWKNKICIPALVLLLSGCGLTQAVTDGTVSATKSLFYKQIKVLHLDFTARE
ALNTDEHEANSSSEPVMVRAYQLRDDKTFLKTVYQQLASDGEAALKDDLLASRSVVVKPGGAVTLDMPME
KETQFVAVVALFRHPDMVKDHWRLILTLDDLHPDKPRTLELGNNSLILRAETK
 
Nucleotide Sequence: 582 bp     [Download]
>gi|153946813|ref|NC_009708.1|:964187-964768 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
GTGTTAGCTATTACTTCGAAAAATAAAATCTGTACTTCGAAAAATAAAACTTGGGCCGCCTGGAAAAATA
AAATCTGCATCCCAGCATTGGTCTTATTGCTCAGTGGCTGTGGGCTGACGCAAGCCGTGACTGATGGCAC
CGTGTCTGCCACAAAATCACTGTTTTATAAGCAGATAAAGGTACTGCATTTGGATTTTACCGCCCGTGAA
GCTCTGAATACCGATGAGCACGAAGCGAACTCGTCATCGGAACCGGTGATGGTGAGGGCTTATCAGTTAC
GTGATGATAAAACCTTCTTAAAAACGGTGTATCAACAGTTGGCGAGCGACGGGGAGGCGGCACTTAAAGA
TGACCTGCTGGCCAGCCGCAGCGTGGTAGTGAAACCAGGCGGTGCGGTAACATTGGATATGCCGATGGAA
AAAGAGACCCAGTTTGTGGCAGTGGTGGCGCTGTTCCGACATCCAGATATGGTCAAAGACCACTGGCGTC
TGATTCTGACGCTGGACGACCTGCATCCCGATAAACCTCGGACCCTTGAGTTGGGTAATAACAGCCTGAT
ATTGCGGGCGGAGACAAAGTAA