SecReT6
Protein ID: 153950380
SecReT6 ID222
T6SS typei2
Gene symbol-
Locus tagYpsIP31758_0805
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]965818..967215 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDA7FEW1
KEGG IDypi:YpsIP31758_0805
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.50E-51, Aligned region: 121..150
DUF3702 [PF12486], Evalue: 2.50E-51, Aligned region: 312..458
ImpA-rel_N [PF06812], Evalue: 1.20E-19, Aligned region: 40..100
ImpA-rel_N [PF06812], Evalue: 1.20E-19, Aligned region: 108..120
ImpA-rel_N [PF06812], Evalue: 1.20E-19, Aligned region: 240..253
Protein Sequence: 465 a.a.     [Download]
>gi|153950380|ref|YP_001399789.1| ImpA domain-containing protein [Yersinia pseudotuberculosis IP 31758]
MTHLPERHLKTGGDPRHFAEFSALRNEIGKLHHPARPDVDWTRVEQLCLALFRQNGVELQTTVDFTLART
HVAGLAGLCEGLELLAGLLSHQWSTLWPPQTHARVELLAWLSDRLQQVWRTMTLCYGDLALVYRAEQALE
QLCTQLQTLELKHLSKLDGVRLMLHNAALRLESAEAGADTPDRLTVPIRHAELSEPQPTFVSATASVPLV
YIVNEPAPPSVQVALAPPEPPPPPRWKVGHGFIAGLLLMAVLMTGGFAIWQSLSSDPLREALLANASPLP
TLLTAKSINELQKQTSDAELGRLAEPVLQASGSQLEQLAILPPLWAQIRGDALLSQAQQLWPASQDVKRL
STLWQQQREAGAAPLGELKHYALAQERLRQLADRLNGLDEKKGRYMTVSELKTVVFAIQQPLAKTLPLEE
LLRQYQAQSESGQTPSSALRQQIDSRFTQLLNRYALLTLPETASP
 
Nucleotide Sequence: 1398 bp     [Download]
>gi|153946813|ref|NC_009708.1|:965818-967215 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGACACACTTACCTGAACGCCACCTGAAAACCGGCGGCGACCCCCGCCATTTTGCTGAATTCAGCGCCT
TACGTAACGAAATCGGTAAATTACACCATCCCGCCCGCCCGGATGTTGACTGGACGAGGGTCGAGCAGCT
TTGTCTCGCACTGTTTCGCCAGAATGGCGTTGAGCTACAGACCACGGTTGATTTTACGCTGGCTCGGACG
CACGTTGCTGGGCTGGCCGGGTTATGTGAGGGGCTGGAACTGCTGGCGGGATTGCTCTCTCATCAATGGA
GCACCTTGTGGCCGCCGCAAACCCATGCGCGGGTGGAGTTACTGGCTTGGCTGAGTGACCGATTGCAACA
GGTCTGGCGTACCATGACCCTGTGCTACGGTGATCTGGCGCTGGTTTACCGTGCTGAGCAGGCGCTGGAA
CAACTCTGCACGCAACTGCAAACGTTGGAACTCAAGCATCTGAGTAAACTGGACGGTGTTCGCCTCATGT
TGCATAACGCCGCATTGCGGCTAGAGAGTGCCGAAGCGGGCGCTGATACACCCGACCGATTGACTGTGCC
AATACGGCACGCCGAGCTCTCGGAACCACAACCCACCTTCGTGTCGGCCACAGCCAGTGTTCCGCTGGTC
TATATTGTCAACGAACCGGCTCCGCCGAGTGTACAGGTGGCTTTAGCCCCACCTGAGCCGCCACCCCCTC
CGCGCTGGAAAGTCGGGCACGGTTTTATTGCCGGGTTATTGTTGATGGCGGTGCTGATGACGGGCGGTTT
TGCTATCTGGCAGTCACTCTCATCCGATCCGTTGCGGGAGGCATTACTCGCCAATGCCAGCCCTTTACCC
ACACTGCTGACGGCTAAATCAATCAATGAACTGCAAAAGCAGACCTCAGACGCCGAACTGGGACGTTTGG
CTGAACCCGTGCTGCAAGCCAGTGGCTCACAGTTAGAACAATTGGCGATATTGCCACCGTTATGGGCGCA
AATACGGGGTGATGCACTGTTATCACAAGCACAACAATTGTGGCCCGCCAGCCAAGACGTTAAGCGTTTG
AGCACATTGTGGCAGCAACAACGAGAGGCTGGAGCCGCCCCGCTGGGGGAGTTGAAACACTATGCACTGG
CGCAAGAGCGCCTACGGCAACTGGCCGATCGCCTAAATGGATTGGATGAGAAAAAGGGGCGCTATATGAC
GGTCTCGGAGCTGAAAACGGTGGTCTTTGCGATACAACAACCGCTGGCAAAAACCTTACCGCTGGAAGAG
TTGCTGCGGCAGTATCAGGCACAGTCCGAGTCAGGGCAAACTCCATCTTCAGCACTGCGCCAACAGATTG
ACAGCCGGTTTACTCAACTGCTGAACCGGTATGCGTTACTCACGTTGCCCGAAACGGCATCGCCGTAG