SecReT6
Protein ID: 153950460
SecReT6 ID221
T6SS typei2
Gene symbol-
Locus tagYpsIP31758_0728
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]889748..891100 [+]
Producthypothetical protein
NoteTssK
UniProt IDA7FEN9
KEGG IDypi:YpsIP31758_0728
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.20E-134, Aligned region: 18..447
Protein Sequence: 450 a.a.     [Download]
>gi|153950460|ref|YP_001399717.1| hypothetical protein YpsIP31758_0728 [Yersinia pseudotuberculosis IP 31758]
MKIERPLWARGILVSPQQFQQQASWEAWTNECIAQMAVMHPWGVLQAVFEPDALAQGRLKAARLHVRFPD
GVLVDTECADVLPPTLTLAASLPAEASDATVMLAIPQLYANGGNCLQPDERGERPVRHRQAWRDVQNQFG
DDKKQVAVMHHQLTLRLDTQENGDYQVCPVARLLRDAQGRWTLDPGFIPPMLSLQASAWCGEQLELLMVQ
LRARLQRLMGMRRESNARMADFAVADVSLFWLLNALNSAEPVLGNFQRYPQIHPERLYQELARLAGSLLT
FSLEHEVTAIPVYQHEQLTRVFPPLFALLNILLEASLPSRVVAIELVHEPRINQWRATLRDPRLREGADF
YLSVRSSLPAAQLQTQFPQLCKAGAPDEVGNVVNVALSGIPLRPLSHVPAAIPLRLENQYFSLDLSHPAA
TQMMETGACVFYVPGTLGEIQLELFAVLRA
 
Nucleotide Sequence: 1353 bp     [Download]
>gi|153946813|ref|NC_009708.1|:889748-891100 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGAAAATTGAACGCCCTCTGTGGGCTCGCGGGATCCTGGTGTCTCCGCAACAATTTCAACAACAGGCTT
CCTGGGAGGCCTGGACCAATGAATGCATTGCGCAAATGGCCGTGATGCATCCCTGGGGCGTGCTTCAGGC
TGTTTTCGAGCCGGATGCGCTGGCACAGGGCCGCCTGAAAGCGGCGCGTCTGCATGTGCGTTTTCCGGAC
GGTGTGCTGGTGGATACCGAGTGTGCTGATGTGCTGCCGCCCACGCTGACGCTGGCAGCCAGTCTGCCCG
CCGAGGCCAGCGACGCCACGGTGATGCTGGCGATACCACAACTGTATGCCAATGGCGGTAACTGCCTGCA
GCCGGATGAGCGGGGCGAACGCCCGGTACGCCATCGTCAGGCCTGGCGCGATGTCCAAAATCAGTTCGGC
GATGACAAAAAGCAGGTCGCGGTGATGCACCACCAACTGACCCTGCGGCTGGACACTCAGGAAAACGGCG
ATTATCAGGTCTGCCCGGTGGCGCGCTTGCTGCGGGATGCGCAAGGTCGCTGGACACTGGATCCGGGCTT
TATTCCGCCGATGCTGAGCCTGCAGGCCAGTGCCTGGTGTGGCGAACAGCTTGAGTTATTGATGGTGCAA
CTGCGGGCGCGTTTGCAGCGTCTGATGGGGATGCGCCGGGAGAGCAATGCACGGATGGCCGATTTTGCTG
TTGCGGATGTGTCGCTGTTCTGGCTGCTCAATGCCCTTAACAGTGCCGAACCGGTATTGGGGAATTTTCA
GCGCTATCCGCAGATCCACCCGGAACGGCTGTATCAGGAACTGGCCAGGCTGGCGGGCAGCCTGCTGACG
TTCTCCCTTGAGCACGAAGTGACGGCGATCCCGGTTTATCAGCATGAACAACTGACCCGCGTCTTTCCCC
CGTTGTTTGCCCTGCTGAATATTCTGCTGGAAGCCAGCCTCCCTTCACGGGTAGTGGCGATTGAGCTGGT
TCATGAACCGCGTATCAATCAGTGGCGCGCGACCCTGCGTGACCCTCGTCTGCGCGAAGGGGCCGATTTC
TACCTGTCGGTCCGTTCCTCGTTGCCCGCGGCCCAATTGCAGACTCAGTTCCCGCAGTTGTGTAAAGCCG
GTGCGCCAGATGAGGTCGGTAACGTGGTGAATGTTGCGCTGAGTGGCATCCCACTGCGTCCACTCAGCCA
TGTCCCTGCCGCCATCCCCTTGCGGCTGGAAAACCAGTACTTCTCCCTTGATCTCAGCCACCCTGCGGCG
ACGCAGATGATGGAGACGGGGGCCTGTGTGTTCTATGTACCCGGTACGCTGGGTGAGATCCAACTGGAGC
TGTTTGCGGTGCTACGCGCATGA