SecReT6
Protein ID: 153950468
SecReT6 ID224
T6SS typei2
Gene symbol-
Locus tagYpsIP31758_2489
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]2811602..2813365 [-]
Producthypothetical protein
NoteTssF
UniProt IDA7FJN0
KEGG IDypi:YpsIP31758_2489
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.90E-184, Aligned region: 6..583
Protein Sequence: 587 a.a.     [Download]
>gi|153950468|ref|YP_001401458.1| hypothetical protein YpsIP31758_2489 [Yersinia pseudotuberculosis IP 31758]
MDDLTLRYFDAEMRYLREAGEEFARAHPDRAAGLNLDKAGARDPYVERLFEGFAFLMGRMREKLDDDLPE
LTEGLVSLLWPHYLRTIPSLSIVEFTPQWQGMKERMGVSKGFEVLSRPIGERETRCRYTTTQDMDLLPLT
LSRAKLDSEPDGRSVIRLRFDCSALADWSRINLSRLPLYFDADAPLACALHEALTLNTAKLWIRLPGQAD
RQPLDGHFAPLGFGEQDTLWPKADSAFSGYQLLLEYFTFREKFMFVALQGLDGIELPAELPWFEIDVVLE
KRWQHDFSFSEKNLRLHCVPVINLFPLESDPLSLSSLQTEYLLRPMRIQDGYTEVYSVDSVISSRHTGHQ
VYVPFTSFRHKGGMLRHDAPEYYYHTRVKRGPSGLHDTWLVLGGEAFDNHSVPDNENLSLSLTGTNGQLP
RKALQSTVLDTAVKSTGAQVRVRNLSAPSLPCYPPNRDRFHWRVLSHLGSSFLWMMDNAEVLRGTLALYD
WTDNEMNRRRLEAIAEVKHSEIERFERGYLLRGVHIEITLDSNGFTGTGDICLFGEMLSRFFALYTDIHL
FNRLTLILQPTGERLEWEENHQSRLPG
 
Nucleotide Sequence: 1764 bp     [Download]
>gi|153946813|ref|NC_009708.1|:c2813365-2811602 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGGACGACTTAACCCTGCGTTATTTTGACGCTGAAATGCGCTACCTGCGTGAAGCGGGCGAAGAGTTTG
CCCGCGCGCACCCTGATCGGGCTGCCGGATTAAATCTGGATAAAGCCGGGGCGCGTGACCCCTATGTGGA
ACGCCTGTTTGAAGGCTTTGCCTTCCTGATGGGCCGCATGCGAGAAAAACTGGATGATGACCTGCCGGAG
CTGACCGAAGGGTTGGTCAGCCTGCTGTGGCCGCACTACCTGCGCACTATTCCGTCGCTTTCTATTGTGG
AGTTCACCCCACAATGGCAGGGGATGAAAGAACGCATGGGGGTGAGCAAAGGTTTTGAAGTGCTGTCCCG
CCCCATTGGTGAGCGTGAAACTCGCTGCCGCTACACCACCACGCAGGATATGGACTTGCTCCCGCTGACA
TTGAGCCGAGCCAAATTGGACAGTGAACCCGATGGCCGGTCGGTTATCCGGCTGCGCTTTGATTGCAGCG
CGCTGGCCGACTGGAGCCGTATCAACCTGAGCCGCCTGCCGCTCTATTTTGATGCCGATGCGCCGCTGGC
CTGCGCCCTGCATGAGGCGCTGACCCTGAATACCGCCAAACTCTGGATCCGTTTGCCGGGGCAGGCTGAT
CGCCAGCCGCTGGACGGCCATTTCGCGCCGCTGGGGTTCGGGGAGCAGGATACACTGTGGCCGAAGGCCG
ACAGTGCGTTCAGTGGTTATCAGCTCTTGCTGGAGTACTTTACCTTCCGCGAAAAGTTTATGTTTGTCGC
GTTGCAGGGGCTGGATGGGATCGAGCTGCCGGCGGAACTGCCGTGGTTTGAGATTGATGTGGTGCTGGAA
AAACGCTGGCAACATGATTTTTCGTTCTCCGAAAAGAACCTGCGCCTGCATTGTGTGCCGGTGATTAACC
TGTTCCCGCTGGAATCGGACCCACTGTCGCTCTCTTCATTACAGACCGAATACCTGCTGCGCCCAATGCG
CATTCAGGACGGTTATACCGAAGTGTATTCGGTGGACTCGGTGATCTCCTCGCGTCATACCGGGCATCAG
GTCTATGTCCCGTTCACCAGTTTTCGCCATAAGGGCGGGATGCTGCGCCATGATGCGCCGGAATATTACT
ACCATACGCGGGTCAAACGCGGGCCTTCGGGGCTGCACGATACCTGGCTGGTGCTGGGAGGCGAGGCGTT
TGATAACCATAGCGTACCCGATAATGAGAATCTGTCGCTGAGCCTGACCGGCACCAACGGGCAATTACCG
CGTAAAGCGCTGCAAAGCACGGTGCTGGATACCGCGGTGAAATCCACCGGGGCTCAGGTTCGGGTGCGTA
ATCTGTCCGCGCCGTCATTGCCGTGTTACCCACCCAACCGCGACCGTTTTCACTGGCGGGTACTGAGCCA
TCTGGGCAGCAGTTTTCTGTGGATGATGGATAACGCTGAAGTGCTGCGCGGCACGCTGGCGCTGTATGAC
TGGACGGACAACGAAATGAACCGCCGTCGGCTGGAGGCTATCGCCGAGGTCAAACACAGCGAGATTGAAC
GCTTTGAACGGGGCTATTTGTTGCGCGGGGTGCACATTGAAATCACCCTCGACAGCAACGGCTTTACCGG
CACCGGGGATATCTGTCTGTTCGGGGAAATGCTCAGTCGCTTCTTTGCCCTGTATACCGATATTCATCTG
TTTAATCGCCTGACTCTGATACTGCAACCGACAGGAGAACGTTTGGAATGGGAAGAGAATCATCAGTCCC
GCCTTCCCGGCTAA