SecReT6
Protein ID: 153950470
SecReT6 ID221
T6SS typei2
Gene symbol-
Locus tagYpsIP31758_0731
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]893523..894014 [+]
Producthypothetical protein
NoteTssD
UniProt IDA7FEP2, A7FEP2
KEGG IDypi:YpsIP31758_2506, ypi:YpsIP31758_0731
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.00E-36, Aligned region: 6..146
Protein Sequence: 163 a.a.     [Download]
>gi|153950470|ref|YP_001399720.1| hypothetical protein YpsIP31758_0731 [Yersinia pseudotuberculosis IP 31758]
MAIPVYLWLKDDGGADIKGSVDVQSREGSIEIVAQDHNLYIPTDNNTGKLTGTRIHTPFVFTKEIDASTP
YLYKAVTTGQTLKTAEFKWYRIDDAGQEVEYFNTKLENVKVVKVAPKMHDVKDPAKEKHNHLELVELRYE
KITWTFKDGNIIHSDSWNERATA
 
Nucleotide Sequence: 492 bp     [Download]
>gi|153946813|ref|NC_009708.1|:893523-894014 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGGCAATTCCAGTTTATCTGTGGCTGAAAGACGACGGCGGTGCGGACATCAAGGGTTCTGTTGATGTAC
AAAGCCGTGAAGGCAGCATTGAGATCGTGGCACAGGATCATAACCTGTACATCCCAACCGATAACAACAC
CGGCAAACTGACCGGTACCCGTATCCACACCCCGTTCGTTTTCACCAAAGAAATCGATGCGTCGACCCCG
TACCTGTACAAAGCGGTGACCACCGGTCAGACACTGAAAACCGCCGAGTTCAAATGGTACCGCATTGATG
ACGCTGGCCAGGAAGTTGAATATTTCAACACCAAACTGGAAAACGTCAAAGTGGTCAAAGTTGCGCCGAA
AATGCACGACGTGAAAGATCCGGCGAAAGAGAAGCACAACCACCTGGAACTGGTGGAACTGCGCTACGAA
AAAATCACCTGGACCTTTAAAGACGGCAACATCATTCATTCCGATTCGTGGAACGAGCGCGCCACCGCGT
AG