SecReT6
Protein ID: 153950535
SecReT6 ID222
T6SS typei2
Gene symbol-
Locus tagYpsIP31758_0782
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]938848..939339 [+]
Producthypothetical protein
NoteTssD
UniProt IDA7FET9, A7FET9
KEGG IDypi:YpsIP31758_0782
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.80E-35, Aligned region: 6..146
Protein Sequence: 163 a.a.     [Download]
>gi|153950535|ref|YP_001399767.1| hypothetical protein YpsIP31758_0782 [Yersinia pseudotuberculosis IP 31758]
MAIPVYLWLKDDGGADIKGSVDVQSREGSIEIVAQDHNLYIPTDNNTGKLTGTRIHTPFVFTKEIDASTP
YLYKAVTTGQTLKTAEFKWYRIDDAGQEVEYFNTKLENVKVVKVAPKMHDVKDPAKEKHNHLELVELRYE
KVTWTFKDGNIIHSDSWNERATA
 
Nucleotide Sequence: 492 bp     [Download]
>gi|153946813|ref|NC_009708.1|:938848-939339 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGGCAATTCCAGTCTATCTGTGGCTGAAAGACGACGGCGGTGCGGACATCAAGGGTTCTGTTGATGTGC
AAAGCCGTGAAGGCAGCATTGAGATCGTGGCACAGGACCATAACCTGTACATCCCAACGGATAACAATAC
CGGCAAGCTGACCGGTACGCGTATCCATACCCCATTTGTTTTCACCAAAGAGATCGATGCGTCTACCCCT
TATCTGTACAAAGCGGTAACCACCGGTCAGACGCTGAAAACCGCTGAATTCAAATGGTACCGCATTGATG
ACGCTGGCCAGGAAGTTGAGTATTTCAACACCAAACTGGAAAACGTCAAAGTGGTCAAAGTTGCGCCGAA
AATGCACGACGTCAAAGATCCGGCTAAAGAGAAGCACAACCATCTGGAACTGGTGGAATTGCGCTACGAA
AAAGTCACCTGGACCTTCAAAGACGGCAACATCATTCATTCCGATTCTTGGAACGAACGCGCCACAGCAT
AG