SecReT6
Protein ID: 153950607
SecReT6 ID222
T6SS typei2
Gene symbol-
Locus tagYpsIP31758_0781
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]937113..938834 [+]
ProductOmpA domain-containing protein
NoteTagL
UniProt IDA7FET8, A7FET8
KEGG IDypi:YpsIP31758_0781
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 6.50E-15, Aligned region: 446..542
Protein Sequence: 573 a.a.     [Download]
>gi|153950607|ref|YP_001399766.1| OmpA domain-containing protein [Yersinia pseudotuberculosis IP 31758]
MSPLWRYGLWLWAGLLAGILCLAFLPFSPLVGWLMLLPVALICLVGIGRARRQPNRAFSEPLFSGLASEN
PLPPENHRLPVVLVCGDGLTSLFGTERMLQTAQGCWLRVDEINSLQLFTRQLLWQRPEWAAQLAVMMVVN
PQQRSDERQLAADLQELRWQLMQLCSDTRHRIPLLVSSTVATLMAHDAVWLSQQQTPPLTLWSTVSTPGS
LADWQRTQSNVVQAERLKQTVLFSCHHDWLKAQVLPVLQARNEDVAPVAVQQIIQQQVAGLPDIEQSSLW
QHWLTAHTSLTQVSGWHPPSTAAHDVLPLPDFVFSVLPLGSGVSSRRRVLRHSVTLLTLAAMVALCSSAW
QNRQLLQRVTFDIRHYYSVAMTDHAPKAQAVAVLRGDAEELDNEFRNGEPLRLGLGLYQGWRLRLPLLAA
VKTYVPPPPAIDKETPTTVRLDSLSLFDVGKFQLKPGSIKMLVDALMNIRAKPGWLIVVAGHTDITGDAQ
ANQILSLKRAEALRDWMLSTSDVSPTCFAVQGYGATRPVATNESAEGRAANRRVEISLVPQADACQVPET
VNRSQEHATSLSK
 
Nucleotide Sequence: 1722 bp     [Download]
>gi|153946813|ref|NC_009708.1|:937113-938834 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGAGTCCGTTGTGGCGATATGGGTTATGGCTATGGGCGGGTCTTCTGGCGGGCATATTGTGTCTGGCGT
TCTTGCCTTTCTCCCCGTTAGTCGGCTGGCTTATGTTGTTGCCGGTTGCCCTTATTTGTCTGGTGGGGAT
AGGGCGGGCGCGGCGTCAACCGAACAGGGCATTCTCTGAACCGCTATTCTCCGGACTAGCATCCGAAAAT
CCGCTTCCACCTGAAAACCACCGTTTACCGGTGGTGTTGGTCTGCGGTGATGGTCTGACGTCATTATTTG
GCACCGAGAGGATGCTGCAGACTGCGCAAGGCTGCTGGCTACGAGTGGATGAGATAAACAGCCTACAACT
GTTTACCCGACAGCTACTGTGGCAACGGCCGGAATGGGCCGCTCAGTTGGCGGTGATGATGGTGGTGAAC
CCGCAGCAACGCAGCGATGAACGCCAGCTGGCAGCCGATTTACAGGAGCTGCGTTGGCAACTGATGCAAC
TGTGTAGCGATACCCGCCATCGCATTCCCTTACTGGTGAGTAGCACGGTGGCCACACTGATGGCCCATGA
TGCGGTTTGGTTGTCACAACAGCAAACTCCGCCGCTGACGCTCTGGTCAACCGTCTCGACGCCGGGATCT
CTGGCCGACTGGCAGCGCACACAAAGCAATGTTGTACAGGCGGAACGACTGAAACAGACGGTGTTGTTCA
GCTGCCATCATGACTGGCTGAAAGCACAAGTGCTCCCGGTGTTGCAGGCGCGCAATGAGGATGTGGCACC
GGTCGCTGTACAGCAGATTATTCAGCAGCAGGTTGCTGGTCTGCCAGATATAGAGCAAAGCTCCCTCTGG
CAACATTGGCTAACCGCCCATACCTCGCTGACACAGGTGTCCGGTTGGCATCCACCGTCGACGGCTGCGC
ATGACGTATTACCCTTGCCGGATTTTGTTTTTTCAGTGCTTCCCCTCGGCAGTGGCGTGTCGTCACGCCG
TCGGGTGCTGCGCCATAGCGTCACCTTACTGACGCTGGCGGCGATGGTGGCTTTGTGCAGCAGTGCCTGG
CAAAACCGGCAACTGTTGCAGCGGGTGACCTTTGATATCCGCCATTACTACAGCGTCGCCATGACCGATC
ACGCCCCTAAAGCGCAGGCCGTTGCGGTATTACGGGGTGATGCGGAGGAACTTGATAACGAGTTCCGCAA
TGGTGAGCCGCTGCGTCTGGGACTGGGTTTGTATCAAGGATGGCGTCTGCGACTGCCTTTACTGGCCGCA
GTGAAAACTTATGTGCCACCACCGCCTGCGATAGATAAAGAAACACCCACTACAGTCCGCCTTGATAGCC
TGTCACTGTTTGATGTGGGCAAATTCCAGCTCAAACCCGGCAGCATCAAGATGCTGGTTGATGCATTGAT
GAATATCAGAGCCAAACCCGGCTGGCTGATTGTGGTCGCCGGGCATACCGACATTACCGGTGATGCACAG
GCCAACCAAATTCTGTCGCTTAAGCGCGCCGAAGCATTACGCGACTGGATGCTATCAACCAGCGACGTCT
CGCCGACCTGCTTTGCGGTGCAAGGCTACGGGGCGACACGCCCGGTCGCGACTAACGAGTCAGCGGAAGG
CCGCGCGGCCAACCGCCGTGTCGAAATTAGTCTGGTACCGCAGGCTGATGCCTGTCAGGTGCCAGAAACA
GTAAACCGGTCGCAGGAACACGCGACCTCACTCAGTAAGTAA