SecReT6
Protein ID: 153950743
SecReT6 ID222
T6SS typei2
Gene symbol-
Locus tagYpsIP31758_0803
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]964768..965217 [+]
Producthypothetical protein
NoteTssE
UniProt IDA7FEV9
KEGG IDypi:YpsIP31758_0803
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.20E-15, Aligned region: 29..116
Protein Sequence: 149 a.a.     [Download]
>gi|153950743|ref|YP_001399787.1| hypothetical protein YpsIP31758_0803 [Yersinia pseudotuberculosis IP 31758]
MPDASSPSLYEQLLGNFTGGLELHQVSEANQVILSVLDNMQRILNCRAGTLSHLPDYGLPDMSEILQGLP
GSAHALLTTLSTALLKYEPRLKSLQVLLLPQTAPGHLEYAIEAELKGLGLVRYGTAFMPEGRVLIRHLKQ
QYLDKTMGV
 
Nucleotide Sequence: 450 bp     [Download]
>gi|153946813|ref|NC_009708.1|:964768-965217 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGCCGGACGCCTCCTCGCCGTCACTGTATGAGCAATTGCTGGGCAATTTCACTGGCGGGCTTGAACTGC
ATCAGGTCAGTGAAGCTAATCAGGTCATTCTCTCGGTGCTCGATAATATGCAGCGCATTCTCAATTGCCG
GGCGGGGACACTCAGTCATCTGCCCGATTATGGTCTGCCAGATATGAGTGAAATCCTGCAAGGGCTACCG
GGCAGCGCACACGCGCTGTTGACCACTCTATCCACTGCATTGCTGAAATACGAGCCGCGTCTGAAAAGTT
TGCAGGTGTTGCTGTTACCGCAGACCGCTCCCGGCCATCTGGAGTACGCCATTGAGGCGGAACTGAAAGG
TCTGGGACTGGTGCGTTATGGCACGGCATTTATGCCAGAAGGCCGGGTGTTGATTCGTCATCTTAAACAG
CAGTATCTTGATAAAACAATGGGAGTCTGA