SecReT6
Protein ID: 153950751
SecReT6 ID222
T6SS typei2
Gene symbol-
Locus tagYpsIP31758_0800
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]961400..963163 [+]
Producthypothetical protein
NoteTssF
UniProt IDA7FEV6
KEGG IDypi:YpsIP31758_0800
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.20E-182, Aligned region: 6..584
XS [PF03468], Evalue: 0.0074, Aligned region: 60..114
Protein Sequence: 587 a.a.     [Download]
>gi|153950751|ref|YP_001399784.1| hypothetical protein YpsIP31758_0800 [Yersinia pseudotuberculosis IP 31758]
MDDLTLRYFDAEMRYLREAGEEFARAPPDRAAGLNLDKAGARDPYVERLFEGFAFLMGRMREKLDDDLPE
LTEGLVSLLWPHYLRTIPSLAIVEFTPQWQGMKERMGVSKGFEVLSRPIGERETRCRYTTTQDMDLLPLT
LSRAKLDSEPDGRSVIRLRFDCSALADWSRINLSRLPLYFDADAPLACALHEALTLNTAKLWIRLPGQAD
RQPLDGHFAPLGFGEQDTLWPKADSAFSGYQLLLEYFTFREKFMFVALQGLDGIELPAELPWFEIDVVLE
KRWQHDFSFSEKNLRLHCVPVINLFPLESDPLSLSSLQTEYLLRPMRIQDGYTEVYSVDSVISSRHTGHQ
VYVPFTSFRHKGGMLRHDAPEYYYHTRVKRGPSGLHDTWLVLGGEAFDNHSVPDNENLSLSLTGTNGQLP
RKALQSTVLDTAVKSTGAQVRVRNLSAPSLPCYPPNRDRFHWRVLSHLGSSFLWMMDNAEVLRGTLALYD
WTDNEMNRRRLEAIAEVKHSEIERFERGYLLRGVHIEITLDSNGFTGTGDICLFGEMLSRFFALYTDIHL
FNRLTLILQPTGERLEWEENHTTRIPG
 
Nucleotide Sequence: 1764 bp     [Download]
>gi|153946813|ref|NC_009708.1|:961400-963163 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGGACGACTTAACCCTGCGTTATTTTGACGCTGAAATGCGCTACCTGCGTGAAGCGGGCGAAGAGTTTG
CCCGCGCGCCCCCTGATCGGGCTGCCGGATTAAATCTGGATAAAGCCGGGGCGCGTGACCCCTATGTGGA
ACGCCTGTTTGAAGGCTTTGCCTTCCTGATGGGCCGCATGCGAGAAAAACTGGATGATGACCTGCCGGAG
CTGACCGAAGGGTTGGTCAGCCTGCTGTGGCCGCACTACCTGCGCACCATTCCGTCGCTTGCCATTGTGG
AGTTCACCCCACAATGGCAGGGGATGAAAGAACGCATGGGGGTGAGCAAAGGTTTTGAAGTGCTTTCCCG
CCCCATTGGCGAGCGTGAAACCCGTTGCCGCTACACCACCACGCAGGATATGGACTTGCTCCCGCTGACA
TTGAGCCGAGCCAAATTGGACAGTGAACCCGATGGCCGGTCGGTTATCCGGCTGCGCTTTGATTGCAGCG
CGCTGGCCGACTGGAGCCGTATCAACCTGAGCCGCCTGCCGCTCTATTTTGATGCCGATGCGCCGCTGGC
CTGCGCCCTGCATGAGGCGCTGACCCTGAATACCGCCAAACTCTGGATCCGGTTGCCGGGGCAGGCTGAT
CGCCAGCCGCTGGACGGCCATTTCGCGCCGCTGGGGTTCGGGGAGCAGGATACACTGTGGCCGAAGGCCG
ACAGTGCGTTCAGTGGTTATCAGCTCTTGCTGGAGTACTTTACCTTCCGCGAAAAGTTTATGTTTGTCGC
GTTGCAGGGGCTGGATGGGATCGAGCTGCCGGCGGAACTGCCGTGGTTTGAGATTGATGTGGTGCTGGAA
AAACGCTGGCAACATGATTTCTCGTTCTCCGAAAAGAACCTGCGCCTGCATTGTGTGCCGGTGATTAACC
TGTTCCCGCTGGAATCGGACCCGCTGTCACTTTCTTCATTACAGACCGAATACCTGCTGCGCCCAATGCG
CATTCAGGACGGTTATACCGAAGTGTATTCGGTGGACTCGGTGATCTCCTCGCGTCATACCGGGCATCAG
GTCTATGTCCCGTTCACCAGTTTTCGCCATAAAGGCGGGATGCTGCGCCATGATGCGCCGGAATATTACT
ACCATACGCGGGTCAAACGCGGGCCTTCGGGGTTGCACGATACCTGGCTGGTGCTGGGGGGCGAGGCGTT
TGATAACCACAGCGTCCCGGATAATGAAAATTTGTCGCTGAGCCTGACCGGCACTAACGGGCAGTTACCG
CGTAAAGCGCTGCAAAGCACGGTGCTGGATACGGCGGTGAAATCCACCGGGGCTCAGGTGCGGGTGCGTA
ATCTCTCCGCGCCGTCATTGCCATGCTACCCGCCGAACCGCGACCGTTTTCACTGGCGGGTGTTGAGCCA
TCTGGGCAGCAGTTTTCTGTGGATGATGGATAACGCTGAAGTGCTGCGCGGAACGCTGGCGCTGTATGAC
TGGACGGACAACGAAATGAACCGCCGTCGGCTGGAGGCTATCGCTGAGGTCAAACACAGCGAGATTGAAC
GCTTTGAACGGGGTTACTTGCTGCGCGGGGTACACATTGAAATCACCCTCGACAGTAACGGCTTTACCGG
TACCGGGGATATTTGTCTGTTTGGGGAAATGCTCAGTCGCTTCTTTGCCCTGTATACCGATATTCATCTG
TTTAATCGCCTGACTCTGATACTGCAACCGACAGGAGAACGTTTGGAATGGGAAGAGAATCACACGACCC
GAATTCCCGGCTGA