SecReT6
Protein ID: 153950765
SecReT6 ID220
T6SS typei1
Gene symbol-
Locus tagYpsIP31758_0328
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]382948..385170 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA7FDJ4
KEGG IDypi:YpsIP31758_0328
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-69, Aligned region: 134..431
Phage_GPD [PF05954], Evalue: 1.20E-69, Aligned region: 609..643
Phage_base_V [PF04717], Evalue: 1.70E-23, Aligned region: 471..563
Protein Sequence: 740 a.a.     [Download]
>gi|153950765|ref|YP_001399322.1| Rhs element Vgr protein [Yersinia pseudotuberculosis IP 31758]
MFAHDKANNNKAADKTGTVTPTHIVSPEAAPTVSGAQMTEIAGGIGDAVGGTAGKRINQAAEVAKTALDA
KAKVLDGGVTPLNLAAGGAGAGLPDSAAAALTRLVKQPSGLQFTLTAASLPPQTFAVVDFTLSEMLSSPF
VLNVGLASADPAVDFAAVLDEDATLFIWREGVLQRSITGMVASFEQGDTGFHQTRYSMVIRPALWRTSLR
RNARIFQQASVEEIITTLLKENGINDFAFGFRHPHPVREFCVQYQESDFDFIQRLTAEEGIFYYFEFSAG
KNTVVYADDVGSLPKGASLPYNPNVAAQAQELSITTFTRSAQVRPAMVQLKDYTFKNPNWAAAFSEQSGE
LQNQRPDYEHFDFPGRFKDAQHGQDFTRYRLDALRNDANLGQGASNDFTLQPGQLFSLYNHPRGDLNHAW
QLLGIQHSGKQMQALEQASGDQGTVLFNHFSFIPHTQTWRPTPLAKPAMDGPQIAMVVGPPGEEIYCDEY
GRIRLQFLWDRYGQSNDNSSCWIRVTQPWAGQGWGMLAIPRIGQEVVVDFLHGDPDQPIVTGRTYHANNI
PPGSLPASKTQMAFRSKTHKGEGYNEMRFEDAKGGEGLFMHAQKDMTTMVLNDRKTDVTQDHSEHIGQDQ
SVTVVRNQSNTIQNDRRVEVTRDQQTEVGNDYQLVVKGEKKEFVTKIRYTEVHEDETLTVTKSIKIHAKQ
GDISISTPNAGITITHDGAIILQGKYIRLAADMIDLNPEE
 
Nucleotide Sequence: 2223 bp     [Download]
>gi|153946813|ref|NC_009708.1|:382948-385170 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGTTTGCTCATGATAAAGCTAATAATAATAAAGCCGCGGACAAGACCGGCACGGTGACGCCGACCCATA
TCGTCTCGCCGGAGGCCGCCCCAACCGTGAGTGGCGCTCAGATGACCGAGATAGCCGGGGGGATCGGGGA
TGCGGTGGGCGGCACTGCCGGTAAGCGCATCAATCAGGCCGCCGAGGTGGCTAAAACTGCCCTGGATGCC
AAGGCAAAAGTCCTGGACGGCGGCGTCACGCCGCTGAATCTGGCCGCGGGCGGGGCCGGTGCGGGATTAC
CGGACAGCGCCGCGGCGGCGCTTACCCGCCTGGTCAAACAGCCCTCCGGCCTGCAATTTACCCTGACGGC
GGCCAGTTTACCGCCCCAGACCTTTGCGGTGGTGGATTTCACCCTGAGCGAGATGCTCTCCTCGCCGTTT
GTGCTCAATGTCGGGCTGGCGAGTGCCGATCCGGCGGTGGATTTTGCGGCGGTATTGGATGAAGACGCCA
CGCTGTTTATCTGGCGCGAAGGGGTACTGCAACGCAGCATCACCGGCATGGTCGCCAGCTTTGAACAGGG
CGATACCGGTTTTCATCAGACCCGCTACAGCATGGTGATCCGCCCGGCGCTGTGGCGCACCAGCCTGCGG
CGCAATGCCCGCATCTTCCAGCAAGCCTCGGTGGAAGAGATCATCACCACCCTGCTGAAAGAGAACGGCA
TCAACGATTTTGCTTTTGGTTTTCGCCACCCGCACCCGGTGCGCGAGTTCTGCGTGCAATATCAGGAGTC
CGATTTTGATTTTATCCAGCGCCTGACGGCAGAAGAGGGGATTTTCTACTACTTCGAGTTCAGCGCCGGG
AAAAATACCGTGGTGTATGCCGATGATGTTGGCTCCCTGCCGAAAGGCGCGTCACTGCCCTATAACCCGA
ATGTGGCGGCGCAGGCGCAGGAACTGAGTATCACCACCTTCACCCGCAGTGCGCAGGTGCGCCCGGCGAT
GGTGCAACTGAAAGACTACACCTTTAAAAACCCGAACTGGGCCGCGGCCTTCAGCGAACAGTCGGGAGAA
CTGCAAAACCAGCGACCGGACTACGAGCATTTTGATTTTCCGGGGCGCTTCAAAGATGCCCAGCACGGGC
AGGATTTTACCCGCTACCGGCTGGACGCACTGCGCAATGACGCCAATCTGGGGCAGGGGGCGAGCAATGA
TTTTACCCTCCAGCCGGGGCAGTTGTTCAGCCTGTACAACCACCCGCGTGGTGATCTGAACCACGCCTGG
CAGTTGCTCGGCATTCAGCACAGCGGCAAACAGATGCAGGCGCTGGAGCAGGCGTCTGGCGATCAGGGCA
CGGTGCTGTTCAACCACTTCAGTTTTATTCCGCATACCCAGACCTGGCGGCCGACGCCGTTGGCTAAACC
GGCGATGGACGGCCCGCAGATCGCCATGGTGGTGGGGCCGCCGGGGGAAGAGATTTACTGCGACGAATAC
GGCCGTATCCGCCTGCAATTTTTATGGGATCGCTACGGGCAGAGCAATGACAACAGCTCCTGCTGGATCC
GGGTAACCCAGCCGTGGGCGGGCCAGGGCTGGGGCATGCTGGCCATTCCGCGTATTGGTCAGGAAGTGGT
GGTGGATTTTCTGCATGGCGATCCGGATCAACCGATTGTCACGGGGCGGACCTATCACGCCAACAACATC
CCGCCGGGGTCGTTACCGGCCAGTAAAACCCAGATGGCGTTCCGCTCAAAAACCCACAAAGGGGAAGGCT
ACAACGAAATGCGCTTCGAGGACGCCAAAGGCGGCGAAGGGCTGTTTATGCATGCGCAGAAAGATATGAC
GACCATGGTGCTGAATGATCGCAAAACCGATGTGACTCAGGACCATTCAGAGCACATTGGGCAAGACCAG
TCCGTGACGGTTGTGCGTAACCAAAGTAATACGATCCAAAATGATCGCCGGGTGGAGGTGACTCGCGATC
AACAAACCGAAGTGGGCAATGATTACCAGCTAGTGGTGAAAGGTGAAAAGAAAGAGTTTGTGACGAAAAT
TCGTTACACCGAAGTGCATGAAGACGAAACGCTCACGGTGACGAAAAGTATTAAAATCCATGCCAAACAA
GGTGATATCAGCATATCAACCCCGAATGCCGGAATTACGATCACCCATGACGGTGCCATTATTCTGCAAG
GGAAATACATTCGTTTAGCGGCCGATATGATCGATCTTAATCCAGAGGAGTAG