SecReT6
Protein ID: 153950860
SecReT6 ID220
T6SS typei1
Gene symbol-
Locus tagYpsIP31758_0317
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]367277..368308 [+]
Producthypothetical protein
NoteTssG
UniProt IDA7FDI3
KEGG IDypi:YpsIP31758_0317
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.20E-93, Aligned region: 19..329
Protein Sequence: 343 a.a.     [Download]
>gi|153950860|ref|YP_001399311.1| hypothetical protein YpsIP31758_0317 [Yersinia pseudotuberculosis IP 31758]
MVENVNGVEARPEGQALDVSRYNFFQLVELLNQLAVAWQGAAPVATPANEAIRFKSTASLAFPTRDVIAL
DTSARGQFELEVSFLGLHGSQSPLPGYYLDSLAWEDAQNENRLTDFMNVFNHRLLTLLHQIWRKYRYYIC
FDNGGDDAFSQRMFSLVGLGSEVVRNKLQINHSKMLAYAGLLASPGRAPEVICSLVSHCFNLPDITLHSW
QLRKVDIAPSQQNRLGTRVKVRGKKYDEKSVLGVNFSIGSRVADRSGKFLLCINKLTREQFLSFLPNGAN
YASLVMFVAFIMRDQFAWDLRLGLAEQQVGGMVLGTEQNSLLGWTSILGDPEQKPSVTIGVME
 
Nucleotide Sequence: 1032 bp     [Download]
>gi|153946813|ref|NC_009708.1|:367277-368308 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
GTGGTTGAGAATGTAAATGGGGTTGAGGCAAGACCCGAAGGGCAGGCATTGGATGTTTCACGTTATAACT
TTTTTCAATTGGTCGAATTGCTCAACCAATTGGCGGTAGCGTGGCAAGGTGCGGCCCCTGTGGCGACCCC
AGCCAATGAAGCCATCCGTTTTAAATCGACCGCCAGTTTGGCATTCCCGACCAGAGATGTGATCGCACTG
GACACCTCCGCCCGAGGTCAATTTGAGCTAGAGGTCTCTTTCCTTGGATTGCATGGCAGCCAATCGCCGC
TACCAGGATATTACCTCGATTCGTTAGCGTGGGAGGATGCGCAGAATGAGAACCGGTTGACGGATTTCAT
GAACGTATTCAATCACCGCCTGTTAACGCTACTGCATCAGATTTGGCGTAAATACCGTTACTACATCTGC
TTTGACAATGGCGGTGATGATGCATTTTCACAACGCATGTTCTCGCTGGTGGGGTTAGGTAGCGAGGTCG
TCCGCAATAAATTGCAGATCAATCACAGCAAAATGCTGGCTTATGCAGGGCTGCTGGCCAGCCCCGGCAG
AGCACCTGAAGTAATTTGCAGCCTTGTCTCACATTGCTTCAATTTGCCAGATATCACCTTACACAGTTGG
CAGCTACGCAAGGTGGATATTGCCCCCTCACAGCAGAATCGCTTGGGGACGAGGGTGAAAGTCCGTGGCA
AGAAATATGATGAAAAATCAGTGCTTGGCGTTAATTTCTCCATCGGTTCACGGGTTGCGGATCGTAGCGG
GAAATTCTTGTTGTGCATCAATAAGCTGACGCGAGAACAGTTCTTATCCTTTTTACCCAACGGGGCTAAT
TACGCCTCGTTAGTGATGTTTGTCGCCTTCATTATGCGCGATCAATTCGCGTGGGATTTACGTCTTGGGT
TGGCCGAGCAACAGGTGGGCGGGATGGTTCTGGGAACCGAGCAAAATAGCCTCTTGGGCTGGACCAGTAT
CCTCGGCGATCCCGAACAGAAACCCAGCGTAACGATTGGTGTAATGGAATAA