SecReT6
Protein ID: 153950870
SecReT6 ID222
T6SS typei2
Gene symbol-
Locus tagYpsIP31758_0801
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]963127..964212 [+]
Producthypothetical protein
NoteTssG
UniProt IDA7FEV7
KEGG IDypi:YpsIP31758_0801
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 8.70E-82, Aligned region: 19..319
Protein Sequence: 361 a.a.     [Download]
>gi|153950870|ref|YP_001399785.1| hypothetical protein YpsIP31758_0801 [Yersinia pseudotuberculosis IP 31758]
MGRESHDPNSRLITRLKRDIGQINFYRFCQLLEQQPGTLPLGSTNNPADDPVRFRPHPGMGFPVSELKAL
ETDPDQPDAPLTARTTFMGLYGVDSPLPTAYIDDITQQREGHEALEGFLDIFNHRFMTQFYRIWRKYSYP
ATFESGGKDNTSQSLLGLIGMGIPGSQQHFATPTSRFLALLGVMRQPGRTAEGVQALVRLLAPFTQADVT
PHCLRTVRLTSQMTFADEGGNWLDGYTVLGDEAIDANSQLLISLQTEDRDEAGDWLPDGPLYTDFLVLLR
VYLGWRYRACIQLTVATRLLPALVLDETPVRLGLTGVLGLDDDTLSDDIPEYYTVELGHYSGLTPQKYQE
GNRRVSYYFEK
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|153946813|ref|NC_009708.1|:963127-964212 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGGGAAGAGAATCACACGACCCGAATTCCCGGCTGATCACTCGGCTTAAGCGGGATATCGGACAGATCA
ATTTTTACCGCTTCTGTCAGTTGCTGGAGCAACAACCGGGAACCTTGCCGCTGGGGAGTACCAATAACCC
GGCGGATGATCCGGTGCGCTTTCGTCCGCATCCGGGCATGGGGTTCCCGGTCAGTGAGCTGAAGGCGCTG
GAAACTGACCCGGATCAGCCTGATGCACCGCTGACGGCGCGCACCACCTTTATGGGGTTGTACGGTGTGG
ATTCTCCCCTGCCGACAGCTTATATCGACGATATTACGCAGCAGCGTGAGGGGCATGAGGCGCTGGAAGG
GTTCCTCGATATCTTCAACCATCGCTTTATGACGCAGTTTTATCGCATTTGGCGCAAATATTCCTATCCG
GCCACTTTTGAGTCGGGCGGCAAAGATAACACCTCCCAAAGCCTGTTGGGGCTGATTGGCATGGGTATTC
CCGGTTCGCAGCAGCATTTTGCCACCCCGACATCACGCTTTCTGGCCCTGCTGGGGGTGATGCGTCAACC
GGGGCGAACTGCCGAAGGGGTACAGGCACTGGTCCGACTGCTGGCCCCCTTTACGCAGGCTGATGTGACG
CCCCATTGCCTGCGTACGGTTCGTCTGACCTCACAGATGACATTTGCCGACGAAGGGGGCAACTGGCTGG
ACGGTTACACCGTACTGGGCGATGAGGCCATCGATGCCAACAGTCAGTTATTGATTTCTCTGCAGACGGA
AGATCGCGACGAGGCCGGTGACTGGTTACCGGATGGCCCATTGTATACCGATTTTCTGGTGCTGTTGCGG
GTGTATCTGGGCTGGCGCTATCGAGCCTGTATTCAACTGACTGTCGCAACACGGTTGCTGCCGGCGTTGG
TGTTGGATGAGACGCCGGTCAGGTTGGGACTGACCGGGGTGCTGGGGCTGGATGACGATACGCTGTCAGA
CGATATACCTGAATACTATACCGTGGAACTGGGACACTACAGTGGACTGACTCCACAGAAATACCAAGAA
GGAAACCGACGTGTTAGCTATTACTTCGAAAAATAA