SecReT6
Protein ID: 15595268
SecReT6 ID3
T6SS typei3
Gene symbol-
Locus tagPA0070
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H1-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]82404..83318 [-]
Producthypothetical protein
NoteTagQ
UniProt IDQ9I762
KEGG IDpae:PA0070
PDB IDNA
Domain hit(s) vs Pfam Gly-zipper_Omp [PF13488], Evalue: 1.10E-07, Aligned region: 71..117
Gly-zipper_OmpA [PF13436], Evalue: 7.80E-06, Aligned region: 58..123
Gly-zipper_OmpA [PF13436], Evalue: 7.80E-06, Aligned region: 191..204
Gly-zipper_OmpA [PF13436], Evalue: 7.80E-06, Aligned region: 257..273
Rick_17kDa_Anti [PF05433], Evalue: 1.10E-05, Aligned region: 70..113
Gly-zipper_YMGG [PF13441], Evalue: 7.90E-05, Aligned region: 67..112
Protein Sequence: 304 a.a.     [Download]
>gi|15595268|ref|NP_248760.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MSQPSENRLITSARYALCLLTASGVLLSGCASSGVGSVAQTTRAEYYPSCYEPVSHLRSTDNAVRNSAIT
GAITGGLLGGLAGGLASDENRGRNAALAAAGGALAGGAAGYYMEKQKQISDDRARIGSYGTDVDRSTVEI
NRSVAYAKSAQSCYQSQFKALLDGRKNKSINEAEGRKRLAEIVSGLQETNALLVAANGRAGENISNYTQA
YEKDLQQVGVPRAEVTKVAEAENRASTTKGGSKPKTGSNPKVPKEAVATEQTIRKAQDAQSEGNKVASQG
QGMIREVCNSPDMGDWAPPSCAKA
 
Nucleotide Sequence: 915 bp     [Download]
>gi|110645304|ref|NC_002516.2|:c83318-82404 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGAGCCAACCCAGCGAAAACCGTTTGATCACCTCGGCGCGCTACGCGCTCTGCCTGTTGACCGCCAGCG
GCGTGCTGCTCAGCGGCTGCGCCAGCAGCGGCGTCGGCTCGGTCGCCCAGACCACCCGCGCGGAATACTA
CCCGTCCTGCTACGAGCCGGTGTCGCACCTGCGCAGCACCGATAACGCAGTGCGCAATTCGGCCATCACC
GGCGCCATTACCGGCGGCCTCCTGGGCGGCCTGGCCGGCGGCCTGGCCAGCGACGAGAACCGCGGCCGCA
ATGCCGCCCTCGCTGCCGCAGGCGGCGCCCTGGCCGGCGGCGCGGCGGGCTACTACATGGAGAAGCAGAA
GCAGATCAGCGATGACCGCGCGCGCATCGGCTCCTACGGTACCGACGTCGACCGCAGCACCGTCGAGATC
AACCGTAGCGTGGCCTACGCCAAGTCGGCGCAAAGCTGCTACCAGAGCCAGTTCAAGGCTCTGCTCGACG
GTCGCAAGAACAAGTCGATCAACGAAGCCGAAGGGCGCAAGCGCCTGGCCGAGATCGTCAGCGGCCTGCA
GGAGACCAACGCCTTGCTGGTCGCCGCCAACGGCCGTGCCGGCGAGAACATCAGCAACTACACCCAGGCC
TACGAGAAAGACCTGCAGCAGGTCGGCGTACCGCGCGCCGAGGTGACCAAGGTCGCCGAGGCCGAGAACC
GCGCCAGCACTACGAAAGGCGGCAGCAAGCCCAAGACCGGCAGCAATCCCAAGGTGCCGAAGGAAGCGGT
CGCCACCGAGCAGACCATCCGCAAGGCCCAGGACGCGCAAAGCGAAGGCAACAAGGTGGCCTCCCAGGGC
CAGGGCATGATCCGGGAAGTCTGCAACAGCCCGGACATGGGCGACTGGGCGCCGCCGAGCTGCGCCAAGG
CCTGA