SecReT6
Protein ID: 15595270
SecReT6 ID3
T6SS typei3
Gene symbol-
Locus tagPA0072
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H1-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]85085..86284 [-]
Producthypothetical protein
NoteTagS
UniProt IDQ9I760
KEGG IDpae:PA0072
PDB IDNA
Domain hit(s) vs Pfam FtsX [PF02687], Evalue: 9.90E-10, Aligned region: 23..50
FtsX [PF02687], Evalue: 9.90E-10, Aligned region: 274..391
Protein Sequence: 399 a.a.     [Download]
>gi|15595270|ref|NP_248762.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MRAGLLLSLAWADYRGEARLSLCAIFALAAVITPLLVLFGLKYGLVSTLTERLERAPSVREIIPVGGARY
RAEDIAALAARADVAFAVPRTRQIAATADLSGGGETALSVEMIPSAAGDPLLAGLPQPDRPTRVVLSHGA
AEKLGAQPGERIVARIGRRMDGQAQSQRLELEVLAVLPQERFARDALFAPLALLEAAEDYRDGRAVAAYG
WPGKAGETPRARIYPGFRLYARDLDAVEGLRRHFVASGVEVATQAEAIAQVRSLSRNLGLVFWIVAALAI
GGAFAAIAASSLAAVERKRRALAVLRLLGFPTAALVGFVMLLALFSAVFGLFLAGLLYAATAGALNHLFD
NQSGEFVCRLLPSHYLTALLATLLCSVLAAASGGWRAARIEAAEGLRDV
 
Nucleotide Sequence: 1200 bp     [Download]
>gi|110645304|ref|NC_002516.2|:c86284-85085 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGCGCGCCGGCCTGCTGCTCTCGCTGGCCTGGGCCGACTACCGCGGCGAGGCGCGCCTGTCGCTCTGCG
CGATCTTCGCCCTGGCGGCGGTGATCACCCCGCTGCTGGTGCTGTTCGGCCTCAAGTACGGCCTGGTCAG
CACCCTCACCGAGCGGCTGGAGCGCGCGCCTTCGGTGCGCGAGATCATTCCGGTCGGCGGCGCCCGCTAC
CGTGCCGAGGACATCGCCGCCCTGGCCGCACGCGCGGACGTCGCCTTCGCCGTGCCGCGCACCCGGCAGA
TCGCCGCCACCGCCGACCTCAGCGGCGGCGGCGAGACCGCCCTGAGCGTCGAGATGATTCCCAGCGCCGC
CGGCGACCCGCTGCTGGCCGGCCTGCCGCAACCCGACCGGCCGACCCGCGTGGTGCTCAGCCACGGCGCC
GCGGAAAAACTCGGCGCCCAGCCTGGCGAGCGCATCGTCGCGCGCATCGGCCGGCGCATGGATGGCCAGG
CACAGAGCCAGCGCCTGGAGCTGGAAGTGCTCGCGGTGCTGCCGCAGGAGCGTTTCGCCCGCGACGCGCT
GTTCGCCCCGCTGGCCCTGCTGGAAGCCGCCGAGGACTATCGCGACGGTCGCGCGGTGGCCGCCTACGGC
TGGCCGGGAAAGGCCGGCGAGACCCCGCGCGCACGCATCTACCCGGGCTTCCGCCTGTACGCCCGAGACC
TCGATGCGGTGGAAGGGCTGCGCCGGCACTTCGTCGCGAGTGGCGTGGAAGTCGCCACCCAGGCCGAGGC
CATCGCCCAGGTGCGCAGCCTCAGCCGCAACCTCGGCCTGGTGTTCTGGATCGTCGCCGCGCTGGCCATC
GGCGGTGCCTTCGCCGCCATCGCCGCCAGCAGCCTGGCCGCCGTCGAACGCAAGCGCCGGGCCCTGGCGG
TGCTACGTCTGCTGGGCTTCCCGACCGCCGCGCTGGTCGGCTTCGTCATGCTCCTGGCGCTGTTCAGCGC
CGTCTTCGGCCTGTTCCTCGCCGGGCTGCTGTACGCCGCCACGGCCGGCGCGCTGAACCACCTGTTCGAC
AACCAGAGCGGCGAGTTCGTCTGCCGCCTGCTGCCCAGCCACTACCTGACGGCGCTGCTCGCCACGCTGC
TGTGCAGCGTCCTGGCCGCCGCCAGCGGCGGCTGGCGCGCGGCGCGGATCGAAGCCGCAGAGGGATTACG
CGATGTTTGA