SecReT6
Protein ID: 15595272
SecReT6 ID3
T6SS typei3
Gene symbolppkA
Locus tagPA0074
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H1-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]87000..90098 [-]
Productserine/threonine protein kinase PpkA
NotePpkA
UniProt IDQ9I758, Q9I758
KEGG IDpae:PA0074
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 7.70E-53, Aligned region: 9..249
Pkinase_Tyr [PF07714], Evalue: 7.10E-36, Aligned region: 10..248
VWA_2 [PF13519], Evalue: 1.50E-13, Aligned region: 96..154
VWA_2 [PF13519], Evalue: 1.50E-13, Aligned region: 616..791
APH [PF01636], Evalue: 1.10E-05, Aligned region: 12..122
APH [PF01636], Evalue: 1.10E-05, Aligned region: 122..150
APH [PF01636], Evalue: 1.10E-05, Aligned region: 214..264
Kinase-like [PF14531], Evalue: 0.00023, Aligned region: 120..212
VWA [PF00092], Evalue: 0.00051, Aligned region: 616..772
Kdo [PF06293], Evalue: 0.0072, Aligned region: 101..149
Protein Sequence: 1032 a.a.     [Download]
>gi|15595272|ref|NP_248764.1| ppkA gene product [Pseudomonas aeruginosa PAO1]
MDIELPGFDIERELGEGAMATVYLATQRSLQRKVALKVMAAALAADPSFAERFLREGRTLARLSHPNTVT
IHDIGNVGSCYYMAMEYLPNGTLKERIQQGLDPEQGLAYVRQVAAALGYAHSQGLVHRDVKPANILFRAD
GTAVLSDFGIAKSIEDNTQFTQVGFAVGTPSYMSPEQARGQEIDGRADLYALGVVLYEILTGKLPYNGKD
SLSTALAHLTEPLPELPIEQGRYQDILRQLLAKDPAERFPTAGALIAALDRLAPSALEATQIRPLATPQG
SPRASNPPPAEPAPLPPADLGGLQPVSIQLPPVTPSAGGATPPPPPPSQAAKPPSPPPPPLPPAKPRAGG
SRTPLIAAAAAAVLLAIGGGAWWLLGSGDAPSAADPAPLGQTPADKPQQQTPVADAEQDGGERPLLMPGK
KTLFQRVLTKPGAAISAEAGGPPRAGAVPAFSVLYVYARKQVGGSPWLRVGASSNGEGDGWLPASAVSDW
KQSLVLKFTERSGRAPVMFLNSAEQVERLLGDTRAARDTLTQAVDHKGDPQVVAVEPNDRAIPQDQFYLL
PIFDSKESFDADGQPAQLLEVASIDPGGSAAAPQAPGQAGQGGASGAASDTFRTGIVLVVDTSVSMQPYI
DRVREVIDGLQRQIGERGDLDKVSFGLVGFRNNTDKTPGLEYVSKTLVPLQPGNDAQRFAELSSQVRATD
VSSHSFNEDAFAGIMQAVDEMDWSPYAGRVVLLVTDAGALRKNDPLGRTQMNEAEVRQAALRKGVKIYAL
HLRTPAGKNNHGYAEQQYRSLTADANPKIADLYIPVAGGEVNAFGNTVKEIGTVFADLVHDAGNRKPQAP
RFDAAPSVASKSAAIGYAMQMEFLGRRDPVRAPQVVTAWTADRDLTNPALPAFQVCVLLSKLQLNELQQS
LKLIVDAAKRTQTSPKDFFQEIASASAYMSRDPAQLVKGSNLAQSGVLGEYLEGLPYRSKSLNMTQDLWL
SLSVAEQQDFIDELESKIRLYETFHNDVANWVRFGDADAGDALYRVPLSTLP
 
Nucleotide Sequence: 3099 bp     [Download]
>gi|110645304|ref|NC_002516.2|:c90098-87000 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGGACATAGAACTTCCGGGATTCGACATCGAACGCGAGCTGGGCGAAGGCGCCATGGCCACGGTCTACC
TGGCCACCCAGCGCTCGCTGCAGCGCAAGGTGGCGCTGAAGGTGATGGCCGCGGCGCTGGCCGCCGACCC
GAGCTTCGCCGAACGCTTCCTGCGCGAAGGTCGGACCCTGGCGCGGCTGTCGCACCCGAACACGGTGACC
ATCCACGACATCGGCAACGTCGGCAGTTGCTACTACATGGCCATGGAATACCTGCCCAACGGCACGCTCA
AGGAGCGCATCCAGCAGGGCCTCGATCCCGAGCAGGGCCTGGCCTACGTACGGCAGGTGGCCGCCGCGCT
CGGCTACGCGCACTCCCAGGGCCTGGTGCATCGCGACGTGAAGCCGGCCAACATCCTGTTCCGCGCCGAC
GGCACCGCGGTGCTCTCGGACTTCGGCATCGCCAAGTCGATCGAGGACAATACCCAGTTCACCCAGGTCG
GCTTCGCCGTCGGCACCCCCAGCTACATGAGCCCGGAGCAGGCCCGCGGGCAGGAGATCGACGGCCGCGC
CGACCTCTACGCGCTGGGCGTGGTGCTCTACGAGATCCTCACCGGCAAGCTGCCCTACAACGGCAAGGAC
TCGCTCTCCACCGCCCTGGCCCACCTCACCGAGCCGCTGCCGGAACTGCCGATCGAGCAGGGCCGCTACC
AGGACATCCTGCGCCAGTTGCTGGCCAAGGACCCGGCCGAGCGCTTCCCCACCGCCGGCGCGTTGATCGC
CGCCCTCGACCGCCTGGCGCCGAGCGCCCTGGAAGCCACCCAGATCCGTCCGCTGGCGACGCCGCAGGGC
TCGCCGCGAGCGAGCAACCCGCCGCCGGCCGAACCCGCGCCCCTGCCGCCCGCCGACCTCGGCGGCCTGC
AACCGGTGTCGATCCAGTTGCCGCCGGTCACGCCCAGCGCCGGCGGCGCCACGCCGCCTCCGCCTCCGCC
GTCGCAAGCGGCGAAACCGCCATCGCCCCCGCCGCCTCCGTTGCCGCCGGCGAAGCCACGTGCCGGCGGC
AGCCGCACGCCGTTGATCGCCGCCGCCGCGGCCGCCGTGCTCCTGGCGATCGGCGGCGGCGCCTGGTGGC
TGCTGGGCTCGGGCGACGCGCCGAGCGCTGCCGATCCAGCGCCGCTGGGACAGACGCCGGCGGACAAGCC
GCAGCAGCAGACCCCGGTGGCCGATGCCGAACAGGACGGCGGCGAGCGTCCGCTGCTGATGCCAGGCAAG
AAGACGCTGTTCCAGCGCGTCCTGACCAAACCCGGCGCGGCCATCTCCGCCGAGGCTGGCGGCCCGCCCC
GGGCCGGCGCGGTGCCGGCCTTCTCGGTGCTCTACGTGTACGCCCGCAAGCAGGTCGGCGGCAGCCCCTG
GCTGCGCGTCGGCGCCTCCAGCAACGGCGAGGGCGACGGCTGGCTGCCGGCTAGCGCGGTGAGCGACTGG
AAGCAGAGCCTGGTGCTGAAGTTCACCGAACGCTCCGGCCGCGCGCCGGTGATGTTCCTCAACAGCGCCG
AGCAGGTCGAGCGCCTGCTCGGCGATACCCGCGCAGCGCGCGACACCCTGACCCAGGCGGTGGATCACAA
GGGCGATCCGCAGGTGGTCGCGGTCGAGCCCAACGACCGGGCGATCCCCCAGGACCAGTTCTACCTGCTG
CCGATCTTCGACTCGAAGGAAAGCTTCGACGCCGACGGCCAGCCGGCGCAGTTGCTGGAGGTCGCCTCGA
TCGACCCCGGCGGCAGCGCCGCGGCACCCCAGGCGCCGGGCCAGGCCGGGCAGGGCGGCGCCAGCGGCGC
GGCGAGCGACACCTTCCGCACCGGCATCGTCCTGGTGGTGGACACCTCGGTGTCGATGCAGCCCTACATC
GACCGCGTGCGCGAGGTGATCGACGGCCTGCAGCGGCAGATCGGCGAGCGCGGCGACCTGGACAAGGTCA
GCTTCGGCCTGGTCGGTTTCCGCAACAACACCGACAAGACCCCCGGCCTGGAATACGTCAGCAAGACCCT
GGTGCCGCTGCAACCGGGCAACGACGCGCAGCGCTTCGCCGAGTTGAGCAGCCAGGTGCGCGCCACCGAC
GTCTCCAGCCACTCGTTCAACGAAGACGCCTTCGCCGGGATCATGCAGGCGGTCGACGAAATGGACTGGT
CGCCCTACGCCGGGCGCGTGGTGCTGCTGGTCACCGACGCCGGCGCGCTGCGCAAGAACGACCCGCTCGG
GCGCACCCAGATGAACGAGGCCGAGGTCCGCCAGGCGGCGCTGCGCAAGGGCGTGAAGATCTATGCCCTG
CACCTGCGCACCCCGGCCGGGAAGAACAACCACGGCTACGCCGAGCAGCAGTACCGCAGCCTCACCGCCG
ACGCCAACCCGAAGATCGCCGACCTCTACATCCCGGTGGCCGGCGGCGAGGTGAACGCCTTCGGCAACAC
GGTGAAGGAGATCGGCACGGTGTTCGCCGACCTGGTCCACGACGCCGGCAACCGCAAGCCGCAGGCGCCG
CGCTTCGACGCCGCGCCAAGCGTGGCGAGCAAGTCGGCGGCCATCGGCTACGCCATGCAGATGGAATTCC
TCGGTCGCCGCGACCCGGTGCGCGCGCCGCAGGTCGTCACCGCCTGGACCGCCGACCGTGACCTGACCAA
CCCGGCGCTGCCGGCGTTCCAGGTCTGCGTGCTGCTGAGCAAGCTGCAACTCAACGAACTGCAACAGTCG
CTGAAACTGATCGTCGACGCGGCCAAGCGCACCCAGACCTCGCCCAAGGACTTCTTCCAGGAAATCGCCA
GCGCCAGCGCCTACATGAGCCGCGACCCGGCGCAACTGGTGAAGGGCAGCAACCTGGCGCAGAGCGGCGT
ACTCGGCGAATACCTGGAAGGCCTGCCGTACCGCAGCAAGTCGCTGAACATGACCCAGGACCTCTGGCTG
TCGCTGAGCGTCGCCGAACAGCAGGACTTCATCGACGAACTGGAGTCGAAGATCCGCCTCTACGAAACCT
TCCACAACGACGTCGCCAACTGGGTCCGGTTCGGCGACGCCGACGCCGGCGACGCGCTGTACCGCGTGCC
GCTGTCGACGCTGCCATGA