SecReT6
Protein ID: 15595273
SecReT6 ID3
T6SS typei3
Gene symbolpppA
Locus tagPA0075
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H1-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]90106..90834 [-]
ProductPppA
NotePppA
UniProt IDQ9I757
KEGG IDpae:PA0075
PDB IDNA
Domain hit(s) vs Pfam PP2C_2 [PF13672], Evalue: 1.40E-13, Aligned region: 20..209
PP2C [PF00481], Evalue: 2.70E-11, Aligned region: 29..234
SpoIIE [PF07228], Evalue: 2.20E-07, Aligned region: 38..240
Protein Sequence: 242 a.a.     [Download]
>gi|15595273|ref|NP_248765.1| pppA gene product [Pseudomonas aeruginosa PAO1]
MVPNSVSYYRSASYSHVGMVRKVNEDASLDAPEAGLWVVADGMGGHAAGDFVSSLIVDTLRRIPAASSLP
AYVGALRTGLAQVNERVRQEAGLRGVSVMGSTLVLLAARGNQASCLWAGDSRLYRLRGGVLEAISRDHSY
VQELLDNALISEEEARHHPRANVVTRAVGVHEQLELSEAALHVLPGDSFLLCSDGLNKTADDSELRDVLS
HSDPYAVVRSLVHLGLTRGAPDNITALVVRAF
 
Nucleotide Sequence: 729 bp     [Download]
>gi|110645304|ref|NC_002516.2|:c90834-90106 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGGTGCCCAACTCAGTCAGCTACTACAGGTCGGCCAGCTACAGCCACGTCGGCATGGTCCGCAAGGTCA
ACGAAGACGCCAGTCTCGACGCCCCCGAGGCGGGACTCTGGGTGGTCGCCGACGGCATGGGCGGCCACGC
CGCCGGCGACTTCGTCAGCAGCCTGATCGTCGATACCCTGCGGCGCATCCCGGCGGCCTCCTCGCTACCG
GCCTATGTCGGCGCGTTGCGCACCGGCCTCGCCCAGGTCAACGAGCGGGTTCGCCAGGAGGCTGGCCTGC
GTGGCGTCAGCGTGATGGGCAGCACCCTGGTACTGCTCGCCGCGCGCGGCAACCAGGCGAGCTGCCTGTG
GGCCGGCGACAGCCGCCTGTACCGCCTGCGCGGCGGCGTGCTGGAAGCCATCTCGCGGGACCACAGCTAC
GTCCAGGAGCTGCTCGACAACGCATTGATCAGCGAGGAAGAGGCGCGCCACCATCCGCGCGCCAACGTGG
TCACCCGCGCGGTCGGCGTGCACGAGCAACTGGAACTGTCGGAAGCCGCGCTGCACGTGCTGCCCGGCGA
CAGCTTCCTGCTCTGCAGCGACGGCCTCAACAAGACCGCCGACGACAGCGAACTGCGCGACGTGCTCAGC
CACAGCGATCCCTATGCGGTGGTCCGCAGCCTGGTCCACCTGGGCCTGACCCGCGGCGCCCCGGACAACA
TCACGGCCCTGGTGGTCAGGGCCTTCTGA