SecReT6
Protein ID: 15595274
SecReT6 ID3
T6SS typei3
Gene symbol-
Locus tagPA0076
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H1-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]90844..91524 [-]
Producthypothetical protein
NoteTagF
UniProt IDQ9I756
KEGG IDpae:PA0076
PDB ID2QNU
Domain hit(s) vs Pfam DUF2094 [PF09867], Evalue: 1.10E-50, Aligned region: 5..142
Protein Sequence: 226 a.a.     [Download]
>gi|15595274|ref|NP_248766.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MNSVGFYGKLAGRGDFVSRGLPNTFVEPWDAWLASGMRASQDELGAAWLDAYLTSPLWRFAIAPGLLGGE
AVTGVVMPSIDRVGRYFPLTVACLLPANADLGGLVGGDDGWFEQVESLLLSTLEPEAEVEAFEQAVAQLP
APPCGPRIEQSLISGNLLRSEAVTPAQRLAALAQHACDGASHWWGRGSARISAGLMRYQGLPPAPAFGRF
LTGEGEVIPLFPGIPG
 
Nucleotide Sequence: 681 bp     [Download]
>gi|110645304|ref|NC_002516.2|:c91524-90844 Pseudomonas aeruginosa PAO1 chromosome, complete genome
TTGAACAGCGTCGGTTTCTACGGCAAGCTGGCCGGCCGCGGCGATTTCGTCAGCCGCGGCCTGCCGAACA
CCTTCGTCGAACCCTGGGACGCCTGGCTGGCCAGCGGCATGCGCGCCAGCCAGGACGAGCTCGGCGCGGC
CTGGCTCGACGCCTACCTGACCAGCCCGCTGTGGCGCTTCGCCATCGCCCCCGGCCTGCTCGGCGGCGAA
GCGGTGACCGGAGTGGTGATGCCGAGCATCGACCGGGTCGGTCGCTATTTCCCGCTGACCGTCGCCTGCC
TGCTACCGGCGAACGCCGACCTCGGCGGGCTGGTCGGCGGCGACGACGGCTGGTTCGAACAGGTCGAGAG
CCTGCTGCTCTCCACCCTCGAACCGGAGGCCGAGGTCGAGGCCTTCGAGCAGGCGGTGGCGCAGCTCCCG
GCACCGCCCTGCGGACCGCGCATCGAACAATCGCTGATCAGCGGCAACCTGCTGCGCAGCGAAGCGGTGA
CCCCGGCGCAGCGCCTCGCCGCGCTGGCCCAGCACGCCTGCGACGGCGCCAGCCACTGGTGGGGACGCGG
CTCGGCACGGATCTCCGCCGGCCTGATGCGCTACCAGGGCCTGCCGCCGGCGCCGGCGTTCGGACGATTC
CTCACCGGAGAGGGCGAGGTGATCCCGCTCTTTCCCGGCATACCCGGTTAA