SecReT6
Protein ID: 15595276
SecReT6 ID3
T6SS typei3
Gene symbol-
Locus tagPA0078
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H1-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]95048..96397 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ9I754
KEGG IDpae:PA0078
PDB ID4B62
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.60E-70, Aligned region: 66..271
OmpA [PF00691], Evalue: 8.60E-16, Aligned region: 339..437
DUF883 [PF05957], Evalue: 0.0075, Aligned region: 90..139
DUF883 [PF05957], Evalue: 0.0075, Aligned region: 202..268
DUF883 [PF05957], Evalue: 0.0075, Aligned region: 336..369
DUF883 [PF05957], Evalue: 0.0075, Aligned region: 397..434
Protein Sequence: 449 a.a.     [Download]
>gi|15595276|ref|NP_248768.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MPPIDDPFGTPAGGGNGSPPDDRTMIMPRPGGRAPEPAGGPRGGDPYTPPPMASLAPLSGRGDGLNPLEQ
AAGPLLAMLTRLRNTIAHPAPASLRAQLLGYLRQFEEKARQAGVAPDEVMLARYVLCTALDEAVLSTPWG
STSDWGKQSLLITLHNEAWGGEKVFQLLEHCLQNPHQRLHLLELLYLCTSLGFEGRYRVMHDGRSQLEAL
RERTAAVIRSTRGEYEHELSPHWRGLSVMRDRLSQYLPPWVGIAIGLALLLALLFGLRMKLAADAEPVFK
RIHAIGEIPVQAIDRPAVQPRVIERPRLARFLADDIKAQRVAVEDAVDRSVVTIRGDELFASASASVRDE
FQPLLLRIADALRKVKGQVLVTGHSDNRPIATLRYPSNWKLSQARAQEVADLLGATTGDAGRFTAEGRSD
TEPVATNASAEGRARNRRVEITVFAEGAQ
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|110645304|ref|NC_002516.2|:c96397-95048 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGCCTCCCATCGACGATCCCTTCGGCACCCCGGCCGGCGGCGGCAACGGAAGCCCGCCCGACGACCGCA
CCATGATCATGCCGCGTCCCGGCGGCCGCGCCCCGGAACCGGCCGGCGGCCCCCGCGGCGGCGATCCCTA
CACGCCGCCGCCGATGGCCAGCCTGGCGCCGCTGAGCGGCCGCGGCGACGGCCTCAACCCGCTGGAGCAG
GCCGCCGGCCCACTGCTGGCGATGCTCACCCGCCTGCGCAACACCATCGCCCATCCGGCGCCGGCCAGCC
TGCGCGCGCAACTGCTCGGCTACCTGCGCCAGTTCGAGGAGAAGGCACGCCAGGCCGGCGTGGCGCCGGA
CGAAGTGATGCTGGCGCGCTACGTGCTCTGCACCGCCCTCGACGAAGCGGTGCTCAGCACGCCGTGGGGC
AGCACCAGCGACTGGGGCAAGCAGAGCCTGCTGATCACCCTGCACAACGAGGCCTGGGGCGGCGAGAAGG
TCTTCCAGTTGCTCGAACACTGCCTGCAGAACCCGCACCAGCGCCTGCACCTGCTGGAGCTGCTGTACCT
GTGCACCAGCCTCGGCTTCGAAGGCCGCTACCGGGTCATGCACGACGGCCGCAGCCAACTGGAGGCGCTG
CGCGAGCGCACCGCGGCGGTGATCCGCAGCACCCGCGGCGAGTACGAGCACGAACTGTCGCCGCACTGGC
GCGGCCTCAGCGTGATGCGCGACCGCCTTTCGCAATACCTGCCGCCGTGGGTCGGTATCGCCATCGGCCT
GGCCTTGCTGCTGGCCTTGCTGTTCGGCCTGCGGATGAAGCTGGCCGCCGACGCCGAGCCGGTGTTCAAG
CGCATCCACGCCATCGGCGAGATCCCGGTGCAGGCCATCGACCGCCCGGCGGTGCAGCCGCGGGTGATCG
AGCGGCCACGCCTGGCGCGCTTCCTCGCCGACGACATCAAGGCCCAGCGAGTGGCGGTGGAGGACGCCGT
CGACCGCTCGGTGGTGACCATCCGCGGCGACGAGCTGTTCGCCAGCGCCAGCGCCAGCGTGCGCGACGAG
TTCCAGCCGCTGCTGCTGCGCATCGCCGACGCCCTGCGCAAGGTCAAGGGCCAGGTGCTGGTCACCGGCC
ATAGCGACAACCGGCCGATCGCCACGCTGCGCTACCCGTCCAACTGGAAACTGTCCCAGGCCCGCGCCCA
GGAGGTCGCCGACCTGCTCGGCGCGACCACCGGCGACGCCGGCCGCTTCACCGCCGAAGGGCGCAGCGAC
ACCGAGCCGGTGGCGACCAATGCCAGCGCCGAAGGCCGCGCACGCAACCGCCGGGTGGAAATCACCGTAT
TCGCGGAGGGCGCGCAATGA