SecReT6
Protein ID: 15595279
SecReT6 ID3
T6SS typei3
Gene symbolfha1
Locus tagPA0081
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H1-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]98263..99756 [-]
ProductFha1
NoteFha
UniProt IDQ9I751, Q9I751
KEGG IDpae:PA0081
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.50E-15, Aligned region: 29..97
Protein Sequence: 497 a.a.     [Download]
>gi|15595279|ref|NP_248771.1| fha1 gene product [Pseudomonas aeruginosa PAO1]
MPLRLTITSYHKLTPGQCSEKVLDQGQLTIGRGPDNDWVLPDPERLVSSRHCTILNRDGVYYLTDTSTNG
VLLVNAGHRLRRGNSEPLQDGETVRLGEYDILVQLGHDIALPGSGNPQTDPFTSFDALMSRQAAGSAPAF
AEPAPTPHPAVTAHFQGGSPLDTKPDLFDFLTPPPPGAAPRPDHVPAEQHDFRPPEPVIPPPPATTPAPP
PAGGAPLIPADWDPFAELLGNTPAPSATPVAQPLPTAEPTPLAMPFADPGITQQPQPQPQPQPQPQPQPQ
PQPQPASVAAPTPPASAAASAGGDLLQAFLRGAGMTQLKVDPAGAEAQMEAIGRSYRGLVEGLVDVLRAR
ASLKGEFRMAQTMIQPVQNNPLKFAPNVDEAMLLLLRRDNQAFMAPDRAVADSFEDLKAHQLAVMAGVQA
AIRHLLARFEPAALEARFGKPAGLSGLLPGARQAQNWDSFTELYAKILREAEDDFQELFGREFSRAYEEH
SARLRRS
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|110645304|ref|NC_002516.2|:c99756-98263 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGCCGCTGCGATTGACCATCACCAGCTACCACAAGCTGACCCCCGGTCAGTGTTCGGAAAAGGTACTGG
ACCAGGGACAGCTGACCATCGGTCGGGGCCCGGACAACGACTGGGTCCTGCCGGACCCGGAGCGCCTGGT
CTCCAGCCGCCACTGCACCATCCTCAACCGCGACGGGGTGTACTACCTCACCGACACCAGCACCAACGGC
GTGCTGCTGGTCAATGCCGGGCACCGCCTGCGCCGCGGCAACAGCGAGCCGCTGCAGGACGGCGAGACCG
TCCGCCTCGGCGAATACGACATCCTCGTCCAGCTCGGCCATGACATCGCCCTGCCCGGCAGCGGCAATCC
GCAGACCGATCCGTTCACCAGCTTCGACGCCCTGATGAGCCGGCAGGCCGCCGGATCGGCGCCTGCCTTC
GCCGAACCGGCGCCCACCCCGCACCCCGCGGTGACGGCGCATTTCCAGGGCGGCTCGCCGCTGGACACCA
AGCCCGACCTGTTCGACTTCCTCACCCCGCCGCCGCCCGGCGCGGCGCCGCGTCCGGACCATGTACCGGC
CGAACAGCACGACTTCCGCCCGCCGGAACCGGTGATCCCGCCGCCCCCCGCGACCACCCCGGCGCCACCG
CCCGCTGGCGGCGCACCGCTGATTCCGGCCGACTGGGACCCGTTCGCCGAACTGCTCGGCAACACGCCCG
CGCCAAGCGCCACGCCCGTCGCCCAGCCGCTGCCGACGGCCGAACCGACGCCGCTGGCGATGCCCTTCGC
CGACCCAGGGATCACCCAACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAG
CCACAGCCACAGCCAGCGAGCGTGGCGGCGCCGACGCCGCCGGCAAGCGCCGCCGCGTCGGCCGGCGGCG
ACCTGCTGCAAGCGTTCCTGCGCGGCGCCGGCATGACCCAGTTGAAGGTCGACCCGGCCGGCGCCGAAGC
GCAGATGGAAGCCATCGGCCGCAGCTATCGCGGCCTGGTGGAAGGACTGGTGGACGTGCTGCGCGCGCGG
GCCAGCCTGAAGGGCGAGTTCCGCATGGCGCAGACCATGATCCAGCCGGTGCAGAACAACCCGCTGAAGT
TCGCGCCGAACGTCGACGAGGCCATGCTGCTCCTGCTGCGCCGCGACAACCAGGCGTTCATGGCGCCGGA
TCGCGCGGTGGCCGACAGCTTCGAAGACCTCAAGGCGCACCAGCTGGCGGTGATGGCCGGCGTGCAGGCC
GCCATCCGCCACCTGCTGGCGCGCTTCGAACCGGCCGCGCTGGAAGCCCGCTTCGGCAAGCCGGCCGGGC
TTTCCGGCCTGCTGCCGGGGGCCCGCCAGGCACAGAACTGGGACAGTTTCACCGAGCTGTACGCGAAGAT
CCTGCGCGAGGCGGAGGACGACTTCCAGGAGCTTTTCGGCCGCGAATTCAGCCGCGCCTACGAGGAACAC
AGCGCTCGACTACGGCGTTCCTGA