SecReT6
Protein ID: 15595284
SecReT6 ID3
T6SS typei3
Gene symbol-
Locus tagPA0086
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H1-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]104006..104851 [+]
Producthypothetical protein
NoteTagJ
UniProt IDQ9I746
KEGG IDpae:PA0086
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 2.70E-43, Aligned region: 159..276
TPR_16 [PF13432], Evalue: 1.80E-07, Aligned region: 21..74
TPR_16 [PF13432], Evalue: 1.80E-07, Aligned region: 132..150
TPR_19 [PF14559], Evalue: 2.60E-05, Aligned region: 26..82
TPR_19 [PF14559], Evalue: 2.60E-05, Aligned region: 131..151
TPR_14 [PF13428], Evalue: 0.0001, Aligned region: 20..59
TPR_14 [PF13428], Evalue: 0.0001, Aligned region: 56..73
TPR_14 [PF13428], Evalue: 0.0001, Aligned region: 113..141
TPR_11 [PF13414], Evalue: 0.0038, Aligned region: 23..71
TPR_11 [PF13414], Evalue: 0.0038, Aligned region: 122..139
BTAD [PF03704], Evalue: 0.007, Aligned region: 14..71
BTAD [PF03704], Evalue: 0.007, Aligned region: 136..144
Protein Sequence: 281 a.a.     [Download]
>gi|15595284|ref|NP_248776.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MADPSFASGRLGSRLQGSIAMIAEELLRAGRLDDALKALQEQVRSQPSNATLRIFLFQLLAVMGQWARAQ
NQLKVVGELDASALPMVQTYSTAIDCEALRREVFAGRLTPVILGQPAEWIAPLLQALSLDAEGHGEAAQA
LREQAFDAAPAVPGRIGEAPFAWLADADTRLGPVLEVIVNGRYAWLPMSNLRSLKVEAPSDLRDLVWLPA
ELTLANGGATVALLPARYAETVEHGDDAARLGRKTEWLDSGLPVGQRLFVTDAGETALFDLRELDFEPTD
A
 
Nucleotide Sequence: 846 bp     [Download]
>gi|110645304|ref|NC_002516.2|:104006-104851 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGGCCGACCCTTCATTCGCATCCGGGCGCCTGGGCTCCCGGCTACAGGGAAGTATCGCGATGATCGCCG
AAGAACTGTTGCGCGCCGGGCGCCTGGACGATGCCTTGAAAGCCTTGCAGGAACAGGTGCGCAGCCAGCC
GTCGAACGCTACCCTGCGGATCTTCCTGTTCCAGCTGCTGGCCGTGATGGGCCAGTGGGCGCGGGCGCAG
AACCAGCTCAAGGTGGTCGGCGAACTGGATGCCTCGGCGCTGCCGATGGTACAGACCTACTCCACCGCCA
TCGACTGCGAGGCGCTGCGCCGCGAGGTGTTCGCCGGGCGCCTGACGCCGGTGATCCTCGGCCAGCCGGC
GGAATGGATCGCGCCGCTGTTGCAGGCCCTGAGCCTGGACGCCGAAGGCCATGGCGAGGCCGCCCAGGCC
CTGCGCGAGCAGGCCTTCGACGCCGCGCCGGCGGTGCCCGGTCGGATCGGCGAAGCGCCGTTCGCCTGGC
TGGCGGATGCCGACACGCGCCTCGGCCCGGTGCTCGAGGTAATCGTCAACGGTCGCTATGCCTGGTTGCC
GATGAGCAACCTGCGCAGCCTCAAGGTCGAGGCGCCGAGCGACCTGCGCGATCTGGTCTGGCTGCCGGCC
GAACTGACCCTGGCCAACGGTGGCGCCACCGTCGCGCTGCTGCCGGCGCGCTACGCGGAAACCGTCGAGC
ACGGCGACGACGCCGCGCGCCTGGGACGCAAGACCGAATGGCTGGACAGCGGCCTGCCGGTCGGCCAGCG
GCTGTTCGTCACCGATGCCGGCGAGACCGCGCTGTTCGACCTGCGTGAACTGGACTTCGAGCCGACGGAC
GCCTGA