SecReT6
Protein ID: 15595289
SecReT6 ID3
T6SS typei3
Gene symbolvgrG1
Locus tagPA0091
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H1-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]110976..112907 [+]
ProductVgrG1
NoteTssI
UniProt IDQ9I741
KEGG IDpae:PA0091
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.00E-88, Aligned region: 26..326
Phage_base_V [PF04717], Evalue: 2.00E-26, Aligned region: 366..459
Protein Sequence: 643 a.a.     [Download]
>gi|15595289|ref|NP_248781.1| vgrG1 gene product [Pseudomonas aeruginosa PAO1]
MQLTRLVQVDCPLGPDVLLLQRMEGREELGRLFAYELHLVSENPNLPLEQLLGKPMSLSLELPGGSRRFF
HGIVARCSQVAGHGQFAGYQATLRPWPWLLTRTSDCRIFQNQSVPEIIKQVFRNLGFSDFEDALTRPYRE
WEYCVQYRETSFDFISRLMEQEGIYYWFRHEQKRHILVLSDAYGAHRSPGGYASVPYYPPTLGHRERDHF
FDWQMAREVQPGSLTLNDYDFQRPGARLEVRSNIARPHAAADYPLYDYPGEYVQSQDGEQYARNRIEAIQ
AQHERVRLRGVVRGIGAGHLFRLSGYPRDDQNREYLVVGAEYRVVQELYETGSGGAGSQFESELDCIDAS
QSFRLLPQTPVPVVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWIRVSQAWAGKNWG
SMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELPANATQSGMKSRSSKGGTPANFNEIRMEDK
KGAEQLYIHAERNQDNLVENDASLSVGHDRNKSIGHDELARIGNNRTRAVKLNDTLLVGGAKSDSVTGTY
LIEAGAQIRLVCGKSVVEFNADGTINISGSAFNLYASGNGNIDTGGRLDLNSGGASEVDAKGKGVQGTID
GQVQAMFPPPAKG
 
Nucleotide Sequence: 1932 bp     [Download]
>gi|110645304|ref|NC_002516.2|:110976-112907 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGCAACTGACCCGCCTGGTCCAGGTGGATTGCCCGCTGGGGCCGGACGTGCTGCTGTTGCAGCGCATGG
AGGGACGCGAGGAACTGGGACGGCTGTTCGCCTACGAGCTGCACCTGGTATCGGAAAATCCCAACCTGCC
GCTGGAGCAGTTGCTCGGCAAGCCGATGAGCCTGTCGCTGGAGCTGCCCGGCGGCAGCCGGCGCTTCTTT
CACGGCATCGTCGCGCGCTGTAGCCAGGTGGCCGGGCACGGCCAGTTCGCCGGCTACCAGGCCACCCTGC
GGCCCTGGCCGTGGCTGCTGACGCGCACCTCGGACTGCCGCATCTTCCAGAACCAGAGCGTGCCGGAGAT
CATCAAGCAGGTGTTCCGCAACCTCGGCTTTTCCGATTTCGAGGATGCCCTCACGCGCCCCTACCGCGAG
TGGGAATACTGCGTGCAGTACCGCGAGACCAGCTTCGACTTCATCAGCCGGCTGATGGAACAGGAAGGCA
TCTACTACTGGTTCCGCCATGAGCAGAAGCGCCACATCCTGGTGCTCTCCGACGCCTACGGCGCGCATCG
CAGCCCGGGTGGCTACGCCAGCGTGCCGTACTACCCGCCGACCCTCGGCCATCGCGAGCGCGACCACTTC
TTCGACTGGCAGATGGCACGCGAGGTCCAGCCCGGTTCGCTGACCCTCAACGACTACGACTTCCAGCGCC
CCGGCGCGCGCCTGGAGGTGCGTTCGAACATCGCCCGGCCGCACGCGGCGGCCGACTACCCGCTGTACGA
CTATCCCGGCGAATACGTGCAGAGCCAGGACGGCGAGCAGTACGCGCGCAACCGCATCGAGGCGATCCAG
GCGCAGCACGAGCGCGTGCGCCTGCGCGGCGTGGTGCGCGGGATCGGCGCCGGGCACCTGTTCCGCCTGA
GCGGCTATCCGCGCGATGACCAGAACCGCGAGTACCTGGTGGTCGGCGCCGAATACCGGGTGGTCCAGGA
ACTCTACGAAACCGGCAGCGGCGGCGCCGGCTCGCAGTTCGAGAGCGAGCTGGACTGCATCGACGCCAGC
CAGTCGTTCCGTCTCCTGCCGCAGACTCCGGTACCGGTGGTGCGGGGTCCGCAGACCGCGGTGGTGGTCG
GACCCAAGGGCGAGGAGATCTGGACCGACCAGTACGGCCGGGTCAAGGTGCACTTCCACTGGGATCGCCA
CGACCAGTCGAACGAGAACAGCTCCTGCTGGATTCGCGTGTCCCAGGCCTGGGCCGGGAAGAACTGGGGT
TCGATGCAGATCCCGCGGATCGGCCAGGAAGTGATCGTCAGCTTCCTCGAAGGCGACCCGGACCGGCCGA
TCATCACCGGGCGGGTCTACAACGCCGAGCAGACGGTGCCCTACGAGCTGCCGGCGAACGCCACCCAGAG
CGGGATGAAGAGCCGTTCGAGCAAGGGCGGCACGCCGGCCAACTTCAACGAGATCCGCATGGAGGACAAG
AAGGGCGCCGAGCAGTTATACATCCACGCCGAGCGCAACCAGGACAACCTGGTCGAGAACGATGCCTCGC
TGTCGGTCGGCCACGACCGCAACAAGAGCATCGGCCACGACGAGCTGGCGCGCATCGGCAACAACCGCAC
CCGCGCGGTGAAGCTCAACGACACCCTGTTGGTGGGCGGGGCGAAGAGCGACAGCGTCACCGGCACCTAC
CTGATCGAGGCCGGCGCGCAGATCCGCCTGGTCTGCGGCAAGAGCGTGGTGGAGTTCAACGCCGACGGCA
CCATCAATATCTCCGGCAGCGCCTTCAACCTCTACGCCAGCGGCAACGGCAACATCGACACCGGCGGCCG
CCTCGACCTCAATTCCGGCGGCGCCAGCGAGGTCGACGCCAAGGGCAAGGGCGTGCAGGGCACCATCGAC
GGCCAGGTACAGGCGATGTTTCCGCCGCCGGCGAAGGGCTGA