SecReT6
Protein ID: 15595290
SecReT6 ID3
T6SS typei3
Gene symbol-
Locus tagPA0092
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H1-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]113022..113306 [-]
Producthypothetical protein
NoteTsi6 (i)
UniProt IDQ9I740
KEGG IDpae:PA0092
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 94 a.a.     [Download]
>gi|15595290|ref|NP_248782.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MTPIEYIDRALALVVDRLARYPGYEVLLSAEKQLQYIRSVLLDRSLDRSALHRLTLGSIAVKEFDETDPE
LSRALKDAYYVGIRTGRGLKVDLP
 
Nucleotide Sequence: 285 bp     [Download]
>gi|110645304|ref|NC_002516.2|:c113306-113022 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGACACCCATCGAATACATCGACCGCGCTCTGGCGCTGGTCGTCGACCGGCTGGCCCGCTATCCGGGAT
ACGAGGTCCTGCTGTCTGCGGAAAAGCAATTGCAGTACATCAGGTCCGTCCTGCTCGACCGCAGCCTGGA
TCGTTCCGCACTGCACCGGTTGACCCTCGGCAGCATCGCCGTGAAGGAATTCGACGAAACCGACCCGGAA
CTCTCCAGGGCCCTCAAGGACGCCTACTACGTCGGTATACGCACTGGCCGCGGCCTGAAGGTCGATCTGC
CCTGA