SecReT6
Protein ID: 15595291
SecReT6 ID3
T6SS typei3
Gene symbol-
Locus tagPA0093
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H1-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]113303..114595 [-]
Producthypothetical protein
NoteTse6 (e)
UniProt IDQ9I739
KEGG IDpae:PA0093
PDB IDNA
Domain hit(s) vs Pfam Toxin_61 [PF15538], Evalue: 3.30E-75, Aligned region: 266..422
PAAR_motif [PF05488], Evalue: 1.20E-14, Aligned region: 4..16
PAAR_motif [PF05488], Evalue: 1.20E-14, Aligned region: 78..153
DUF4150 [PF13665], Evalue: 0.0058, Aligned region: 84..104
DUF4150 [PF13665], Evalue: 0.0058, Aligned region: 125..146
Protein Sequence: 430 a.a.     [Download]
>gi|15595291|ref|NP_248783.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MDAQAAARLGDEIAHGFGVAAMVAGAVAGALIGAAVVAATAATGGLAAVILAGSIAAGGLSMFQIVKGLT
TIFELPEPTTGVLIRGSFNVYVNSRNAMRAGDDVSATCSGLPLNHPLWPFPVLIAEGSATVYINGKPAAR
LQSKMVCGAHIKTGSQNTFIGGPTERVAFVLDLEEWLHTGLEALGLAALAGGLLLAAMAGVAALVGVVAI
GGLMMGGMALLGDLGDRLGPGYRDLFQGVAGMALLGFGPKLAGRRPAAVTSETAQRRAYLNNKFGRSGNL
DHDINYRGNRETAAKFFKSKDIDPADAESYMNGLDFNHPVRVETLAPGKNLWQYQSPGAPQGNWYTLSPR
VQPTELGINPMGTNRAANTIEPKVLNSYRTTQKVEVLRSTAAPTDDFWSVKGQSYPAKGGAQQLFSNEKG
SFGLLPREGS
 
Nucleotide Sequence: 1293 bp     [Download]
>gi|110645304|ref|NC_002516.2|:c114595-113303 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGGATGCGCAAGCCGCCGCCCGACTGGGCGATGAGATAGCCCACGGTTTCGGTGTCGCCGCGATGGTCG
CCGGAGCCGTGGCCGGAGCCCTGATCGGCGCCGCCGTGGTCGCCGCCACCGCCGCCACCGGCGGCCTGGC
CGCGGTGATCCTGGCCGGTTCGATCGCCGCCGGCGGGCTGTCGATGTTCCAGATCGTCAAGGGCCTGACC
ACCATCTTCGAGCTACCCGAGCCGACCACCGGGGTGCTCATACGCGGCAGCTTCAACGTCTACGTGAACA
GTCGCAACGCGATGCGCGCCGGCGACGACGTTTCCGCCACCTGCAGCGGCCTGCCGCTGAACCATCCGCT
GTGGCCGTTCCCGGTGCTGATCGCCGAAGGCAGCGCGACCGTGTACATCAACGGCAAGCCGGCGGCGCGC
CTGCAGAGCAAGATGGTCTGCGGCGCGCACATCAAGACCGGCAGCCAGAACACCTTCATCGGCGGCCCCA
CCGAGCGGGTGGCCTTCGTCCTCGACCTGGAGGAATGGCTGCACACCGGCCTCGAGGCGCTGGGCCTGGC
GGCCCTAGCCGGCGGCCTGCTGCTGGCGGCGATGGCCGGGGTCGCGGCGCTGGTTGGAGTGGTCGCCATC
GGCGGCCTGATGATGGGCGGCATGGCCCTGCTCGGCGACCTCGGCGACCGCCTCGGTCCCGGCTACCGCG
ACCTGTTCCAGGGCGTGGCGGGGATGGCATTGCTGGGCTTCGGGCCGAAACTCGCCGGTCGTCGTCCGGC
AGCGGTGACCTCCGAAACCGCGCAACGACGCGCCTACCTGAACAACAAGTTCGGTCGTTCCGGCAACCTC
GACCACGACATCAACTACCGCGGGAATCGTGAAACCGCCGCCAAGTTCTTCAAGTCGAAGGACATCGATC
CTGCCGATGCCGAGTCGTACATGAACGGCCTGGACTTCAACCATCCGGTCCGTGTGGAAACCCTCGCGCC
CGGCAAGAACCTGTGGCAGTACCAGTCCCCCGGAGCGCCGCAGGGCAACTGGTATACACTCAGCCCGCGC
GTGCAGCCCACGGAGCTGGGAATCAACCCCATGGGCACCAACCGGGCGGCGAACACCATCGAACCCAAGG
TCCTCAACTCCTACAGGACGACCCAGAAGGTCGAGGTCCTGCGCAGCACCGCTGCGCCGACCGATGACTT
CTGGTCGGTAAAGGGACAGTCATATCCCGCCAAAGGCGGCGCGCAACAACTGTTCTCCAACGAGAAAGGC
TCCTTCGGTCTGCTTCCCCGGGAGGGATCATGA