SecReT6
Protein ID: 15595297
SecReT6 ID3
T6SS typei3
Gene symbol-
Locus tagPA0099
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H1-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]120164..121324 [+]
Producthypothetical protein
NotePA0099 (e)
UniProt IDQ9I733
KEGG IDpae:PA0099
PDB IDNA
Domain hit(s) vs Pfam DUF4150 [PF13665], Evalue: 8.40E-38, Aligned region: 19..134
Tox-GHH2 [PF15635], Evalue: 2.20E-33, Aligned region: 226..344
Protein Sequence: 386 a.a.     [Download]
>gi|15595297|ref|NP_248789.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MANEVYANNMEISCKAANGKSIAAFPDVCFTPPQAPPTPLGVPIPYPNTGLSKDTTKGTRTIRITRKEVM
LKNKSYYKTSYGDEPGRAPKKGIVTSKIKGKVYFTSWSMNVKFESKNVVRHLDLTTHNHASFPGNTPVWP
YLDQATVDAGGGPCSNEVKKEKKDCADFKPHGSKDACAGLGAGKPSGKKTSNEADRLADKVAARKCLTAR
RCALQPYKPNSCCPQQTAHHLIEASALHDKGRGGKGSVPLKGISNYSENKAPCVCAEGVNQNVGTHGLMH
TFQSAAAAKSRSGTLQLSNGSSISAKKTTYGTAKRQSMAAMGKVFPQSKCSKECLSAQLDNYHKQCGINA
RTPIKAVETGQTDVTAATQAIKTRNARLGATRSRVR
 
Nucleotide Sequence: 1161 bp     [Download]
>gi|110645304|ref|NC_002516.2|:120164-121324 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGGCCAACGAGGTGTACGCCAACAACATGGAGATCTCCTGCAAGGCGGCGAACGGCAAGTCCATCGCGG
CCTTCCCGGATGTCTGCTTCACCCCGCCGCAGGCGCCGCCGACGCCGTTGGGGGTACCGATCCCCTACCC
CAATACCGGCCTGTCCAAGGACACCACCAAAGGCACCCGGACCATTCGCATCACCCGCAAGGAGGTGATG
CTGAAGAACAAGAGCTACTACAAGACCAGCTACGGCGACGAGCCGGGGCGGGCGCCGAAGAAGGGCATCG
TCACCAGCAAGATCAAGGGCAAGGTGTACTTCACCTCCTGGTCGATGAACGTCAAGTTCGAAAGCAAGAA
CGTGGTTCGCCACCTCGACCTGACCACCCACAACCACGCGTCCTTTCCTGGCAATACGCCGGTCTGGCCC
TACCTCGACCAGGCCACCGTCGATGCTGGTGGTGGACCGTGCAGCAATGAAGTGAAGAAGGAGAAGAAGG
ATTGCGCTGACTTCAAGCCGCATGGCAGCAAGGATGCCTGCGCTGGCCTTGGCGCGGGCAAGCCTTCCGG
CAAGAAGACCAGCAACGAAGCTGACCGACTGGCAGACAAGGTCGCTGCCCGAAAATGCCTGACCGCGCGC
CGGTGTGCCCTGCAACCGTACAAGCCGAACAGTTGCTGCCCGCAGCAGACCGCTCACCACCTGATCGAGG
CCAGCGCCTTGCACGACAAGGGACGTGGTGGAAAAGGCTCGGTACCCCTCAAGGGGATATCCAACTATTC
GGAGAACAAGGCTCCTTGCGTCTGCGCGGAGGGCGTCAATCAGAACGTGGGTACCCACGGCCTCATGCAC
ACGTTCCAGAGCGCCGCTGCCGCGAAGTCGCGCAGTGGAACCCTGCAATTGTCCAATGGCAGCTCCATCT
CCGCGAAGAAGACCACCTACGGAACGGCGAAACGTCAATCCATGGCTGCCATGGGCAAGGTCTTTCCGCA
GTCGAAATGCTCGAAGGAATGTCTGTCCGCTCAGCTCGACAACTATCACAAGCAGTGCGGAATCAACGCC
AGAACACCCATCAAGGCCGTTGAAACCGGCCAGACCGACGTCACGGCTGCGACGCAGGCGATAAAGACCC
GCAATGCGCGTCTTGGCGCCACGAGGAGTCGAGTCCGCTAG