SecReT6
Protein ID: 15596853
SecReT6 ID4
T6SS typei1
Gene symbol-
Locus tagPA1656
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H2-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]1803626..1805182 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ9I369
KEGG IDpae:PA1656
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.20E-22, Aligned region: 55..115
Protein Sequence: 518 a.a.     [Download]
>gi|15596853|ref|NP_250347.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MTYSSKLSSHYLELAEQPISKDVFAGEDVRFSSEYEALENELGKALSLHENGQTDWLKILENSEALLRAQ
SKDLRVAAWLTWALYQRESFPGLLAGLGLLERLCSRHWVEIHPLKARTRAAAIAWLVPRLEQALNENVPI
KEQLPLFRRLAEHLEKLDTALTAQLGDDAPLLLPISRRLSGMLQRAADNQPEPGVVGAVVAQVKQAASQL
LAPGAPIDNERDAHKAMRAQQEAARPLCAWWLKQKATDLRALRLNRTMLWLPIESMPERNAEQVTALRGV
PADKLKSYQERFAQGLYADLLVELEASLARAPFWFDGQRLVWECLQGLNAEQAMREVEMHFALLLQRLPG
LVELRFHDGSAFADAATRGWISAHVMPHLQNDSAPRKVETVALQAEWDVALDEVQPVLRKDGLKAAVQVL
KQGMKRAHGGRARFFWQLSLARLCFLAKKYELAKTQLESLDHQLHESGLHAWEPDLALDVLHLLHSCCEL
LPQNHAVRERKEDIYRRLCHLDLEVVLE
 
Nucleotide Sequence: 1557 bp     [Download]
>gi|110645304|ref|NC_002516.2|:1803626-1805182 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGACCTATTCGAGCAAGCTCTCCTCGCATTATCTGGAACTCGCGGAACAGCCGATTTCAAAGGATGTCT
TTGCGGGTGAGGATGTGCGTTTTTCCAGCGAATACGAGGCGCTGGAAAATGAGCTGGGCAAGGCGCTCTC
GCTCCATGAGAACGGCCAGACCGACTGGTTGAAAATCCTGGAAAACAGCGAAGCGCTGCTTCGTGCCCAA
TCCAAGGACCTGCGTGTTGCAGCCTGGTTGACCTGGGCCCTCTACCAACGGGAATCCTTTCCCGGTTTGC
TGGCCGGACTGGGATTGCTGGAACGTCTGTGCAGCCGGCATTGGGTCGAGATCCATCCGCTCAAGGCGCG
CACTCGCGCCGCGGCCATTGCCTGGCTGGTGCCCCGGTTGGAGCAGGCGCTGAACGAGAACGTACCGATC
AAGGAGCAACTCCCCCTGTTCCGGCGTCTCGCCGAGCACCTGGAAAAACTCGATACCGCGCTGACCGCGC
AACTGGGCGACGACGCGCCCTTGTTGCTGCCGATCAGCCGACGCCTTTCGGGCATGCTCCAGCGCGCCGC
CGACAACCAGCCCGAACCTGGCGTGGTCGGCGCCGTGGTGGCCCAGGTCAAGCAGGCGGCCAGCCAGTTG
CTGGCGCCGGGTGCGCCCATCGACAACGAGCGCGACGCCCACAAGGCCATGCGCGCCCAGCAGGAGGCCG
CACGCCCCCTGTGCGCCTGGTGGCTGAAGCAGAAAGCCACCGATCTGCGCGCGCTGCGCCTCAACCGGAC
GATGCTCTGGCTGCCCATCGAGTCCATGCCCGAGCGCAATGCCGAACAGGTCACCGCGCTAAGGGGAGTG
CCGGCGGACAAGCTGAAAAGCTACCAGGAGCGTTTCGCCCAGGGCCTGTACGCCGATCTCCTGGTGGAGC
TGGAGGCGAGCCTGGCACGGGCGCCGTTCTGGTTCGACGGCCAGCGCCTGGTCTGGGAGTGCCTGCAAGG
GCTCAACGCCGAGCAGGCGATGCGGGAAGTCGAAATGCATTTCGCCTTGCTCCTGCAGCGTCTGCCGGGG
CTGGTGGAGCTGCGTTTCCACGACGGCAGCGCATTCGCCGATGCGGCCACCCGTGGCTGGATCAGCGCCC
ATGTCATGCCCCATCTCCAGAACGACAGTGCGCCGCGCAAGGTCGAGACCGTGGCCCTGCAGGCCGAATG
GGACGTCGCCCTGGACGAGGTCCAGCCGGTGTTGCGCAAGGACGGCCTGAAGGCGGCGGTACAGGTGTTG
AAGCAGGGCATGAAGCGCGCCCACGGCGGGCGAGCCCGGTTCTTCTGGCAACTGAGCCTCGCGCGACTGT
GCTTCCTGGCGAAGAAGTACGAGCTGGCCAAGACCCAGCTGGAGAGCCTCGACCATCAGTTGCACGAATC
GGGATTGCACGCCTGGGAGCCCGATCTGGCGCTGGATGTACTGCACCTGCTGCATAGCTGCTGCGAGCTG
TTGCCGCAGAACCACGCCGTGCGAGAACGCAAGGAAGACATTTATCGCAGGCTGTGCCACCTCGATCTCG
AGGTGGTGCTCGAATAG