SecReT6
Protein ID: 15596854
SecReT6 ID4
T6SS typei1
Gene symbol-
Locus tagPA1657
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H2-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]1805218..1805724 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ9I368
KEGG IDpae:PA1657
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 7.40E-54, Aligned region: 5..159
Protein Sequence: 168 a.a.     [Download]
>gi|15596854|ref|NP_250348.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MAKEGSVAPKERINVTFKPATGGAQEEIELPLKLLAIGDYTQRADERKVEDRKPIGIDKMTFDEVLAKQE
LGLTLSVPNRLQEEGGSDELAVGLQINSMKDFNPASIVEQVPELKKLMELRDALVALKGPLGNAPAFRKA
IESVLADDESRSRVLGELGLSAAPSQDA
 
Nucleotide Sequence: 507 bp     [Download]
>gi|110645304|ref|NC_002516.2|:1805218-1805724 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGGCCAAAGAAGGCTCGGTAGCCCCAAAGGAACGCATCAACGTCACCTTCAAGCCCGCCACTGGCGGTG
CCCAGGAAGAAATCGAACTGCCGTTGAAGCTACTGGCGATCGGCGATTACACCCAGCGCGCGGATGAGCG
CAAGGTGGAGGACCGCAAGCCGATCGGCATCGACAAGATGACCTTCGACGAGGTCCTGGCCAAGCAGGAG
CTGGGGCTGACGCTGAGCGTACCCAATCGTCTCCAGGAGGAGGGCGGCAGCGACGAGCTGGCGGTGGGGC
TGCAGATCAACTCGATGAAGGACTTCAACCCGGCCAGCATCGTCGAGCAGGTGCCCGAGCTGAAGAAGCT
GATGGAGTTGCGCGATGCGTTGGTGGCCCTCAAGGGCCCGCTGGGCAACGCCCCGGCGTTCCGCAAGGCC
ATCGAAAGCGTACTCGCCGACGACGAGTCCCGTAGCCGTGTGCTGGGCGAGCTGGGGCTGAGCGCCGCCC
CCTCCCAGGACGCCTGA