SecReT6
Protein ID: 15596855
SecReT6 ID4
T6SS typei1
Gene symbol-
Locus tagPA1658
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H2-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]1805753..1807228 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ9I367
KEGG IDpae:PA1658
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.70E-192, Aligned region: 64..489
Protein Sequence: 491 a.a.     [Download]
>gi|15596855|ref|NP_250349.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MSTSAAQQGRNQNGEYNILDSIIAETRLSPDDEAYDIAKRGVSAFIEELLKPQNDGEPVKKAMVDRMIAE
IDAKLSTQMDEILHHPDFQALESAWRGLQLLVDRTNFRENIKIEILSVSKQDLLDDFEDSPEVMQSGLYK
HIYTAEYGQFGGQPVGAIIANYYMSPSSPDVKLMQYVSSVACMAHAPFVAAAGPKFFGLESFTGLPDLKD
LKDHFEGPQFAKWQSFRQSEDSRYVALTVPRFLLRTPYDPEENPVKSFAYKETVANSHEHYLWGNTAYAF
GTKLTDSFAKYRWCPNIIGPQSGGAVEDLPLHHFESMGEIETKIPTEVLVSDRREYELAEEGFISLTMRK
GSDNAAFFSASSVQKPKFFGISAEGKAAELNYKLGTQLPYMMIVNRLAHYLKVLQREQLGSWKERTDLEL
ELNKWIRQYVADQENPSAEVRGRRPLRAAQIIVSDVEGEPGWYRVSLNVRPHFKYMGADFTLSLVGKLDK
E
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|110645304|ref|NC_002516.2|:1805753-1807228 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGAGCACCAGTGCCGCACAGCAAGGCCGGAACCAGAACGGCGAATACAACATTCTCGACAGCATCATCG
CCGAGACCCGCCTGAGCCCGGACGACGAGGCCTACGACATCGCCAAGCGCGGCGTCTCCGCCTTCATCGA
GGAATTGCTCAAGCCGCAGAACGACGGCGAGCCGGTGAAGAAGGCGATGGTCGACCGGATGATCGCCGAG
ATCGACGCCAAGCTCAGCACGCAGATGGACGAGATTCTCCATCATCCCGATTTCCAGGCGCTGGAGTCGG
CCTGGCGCGGCCTGCAACTGCTGGTCGACCGCACCAACTTCCGCGAGAACATCAAGATCGAGATTCTCAG
CGTTTCCAAGCAGGACCTGCTGGACGATTTCGAGGACTCGCCCGAGGTGATGCAGTCCGGCCTGTACAAG
CACATCTACACCGCCGAATACGGCCAGTTCGGTGGCCAGCCGGTCGGCGCCATCATCGCCAACTACTACA
TGTCGCCCAGTTCGCCCGACGTCAAGCTGATGCAATACGTCTCCAGCGTGGCCTGCATGGCCCATGCGCC
ATTCGTGGCGGCCGCCGGTCCGAAGTTCTTCGGCCTGGAAAGCTTCACCGGCCTGCCGGACCTGAAGGAC
CTGAAGGATCATTTCGAAGGCCCGCAGTTCGCCAAGTGGCAGAGCTTCCGCCAGTCCGAGGATTCCCGCT
ACGTGGCGCTGACCGTACCGCGCTTCCTGCTGCGCACGCCCTACGATCCGGAAGAGAATCCGGTCAAGTC
GTTCGCCTACAAGGAGACCGTGGCCAACAGCCACGAGCATTACCTGTGGGGCAACACCGCCTATGCCTTC
GGCACCAAGCTGACCGACAGCTTCGCCAAGTATCGCTGGTGCCCGAACATCATCGGGCCGCAGAGCGGCG
GTGCGGTAGAGGACCTGCCGTTGCACCACTTCGAGAGCATGGGCGAGATCGAGACCAAGATCCCCACCGA
GGTGCTGGTGTCCGATCGCCGCGAGTACGAACTGGCCGAGGAAGGCTTCATTTCCCTGACCATGCGCAAG
GGCAGCGACAACGCCGCGTTCTTCTCCGCTAGCTCGGTGCAGAAGCCGAAGTTCTTCGGCATCAGCGCCG
AAGGCAAGGCCGCGGAGCTGAACTACAAGCTCGGCACCCAGTTGCCGTACATGATGATCGTCAACCGCCT
GGCCCATTACCTGAAGGTCCTGCAACGCGAACAGCTGGGGTCGTGGAAGGAGCGTACCGACCTCGAGCTG
GAGCTGAACAAGTGGATCCGCCAGTACGTCGCCGACCAGGAAAACCCCAGCGCCGAAGTGCGCGGCCGTC
GCCCGCTGCGCGCTGCACAGATCATCGTCAGTGACGTCGAGGGCGAGCCGGGCTGGTACCGCGTCAGCCT
GAACGTGCGCCCGCACTTCAAGTACATGGGGGCGGACTTCACCCTGTCGCTGGTCGGCAAGCTGGACAAA
GAGTAA