SecReT6
Protein ID: 15596856
SecReT6 ID4
T6SS typei1
Gene symbol-
Locus tagPA1659
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H2-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]1807241..1807648 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ9I366
KEGG IDpae:PA1659
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.90E-18, Aligned region: 24..114
Protein Sequence: 135 a.a.     [Download]
>gi|15596856|ref|NP_250350.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MTGYGSLFERLNGDADKRVGWSREVSAMASVAAHLGKMLSTRAGSVQTLSDYGLPDLNDMRLSLHDSLSQ
ARSAIEGFIEAYEPRLSDVRVVSLPRDNDQLRLAFSIEGLLEVEGFKRQVSFSACLDGSGQVKVS
 
Nucleotide Sequence: 408 bp     [Download]
>gi|110645304|ref|NC_002516.2|:1807241-1807648 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGACTGGATACGGCAGCCTGTTCGAGCGCCTGAACGGCGACGCGGATAAGCGCGTCGGCTGGAGCCGCG
AGGTTTCCGCCATGGCGTCGGTGGCTGCCCATCTGGGCAAGATGCTCAGCACCCGGGCGGGCAGCGTGCA
GACGCTGTCCGACTACGGGTTGCCCGATCTCAACGACATGCGCCTGAGCCTGCACGACTCCCTGAGCCAG
GCCCGCTCGGCCATCGAAGGTTTCATCGAGGCTTACGAACCGCGCTTGAGCGACGTGCGTGTCGTTTCCC
TGCCACGCGACAACGACCAGCTCCGCCTGGCCTTCAGCATCGAAGGGTTGCTGGAGGTGGAAGGTTTCAA
GCGCCAGGTGAGTTTTTCCGCATGCCTGGATGGCAGCGGCCAGGTGAAGGTCAGCTAA