SecReT6
Protein ID: 15596857
SecReT6 ID4
T6SS typei1
Gene symbol-
Locus tagPA1660
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H2-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]1808193..1809773 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ9I365
KEGG IDpae:PA1660
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.60E-148, Aligned region: 1..526
Protein Sequence: 526 a.a.     [Download]
>gi|15596857|ref|NP_250351.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MMHLLWPNYMRPLPAFSILQFDPLTRPGGALRVERDTPVESRPVGEVACRFRTCYATEVLPLVLEALNYS
VTGEGALLGLRLAMNCDGHLGELGLSRLRLHLAGERYISQMLYLCLLRNLESIQLIPLDAHGRPLDGVAG
KPMSFRLTGERVQPVGFAEDEALIPYPLNTFRGYRYLQEYFAFQDKFLFVDVDGLDLLGALPEETLKQVR
GLELRFDIRKSGIQRLHPTLENVKLYCTPVANLFRHDALPIRLDGKQDEYLLMPAEYSLEDCGVFSVEGV
TGWRPGGLGYQAYVPFESFEHDPSFDVPEARPHYSVRQRTSLLHDGLDTYLSFGIRHPEQIETLSVELTC
TNQNLPQRLRLGDICVACEGTPEFLGFRNITPATPSYAPPLNRDFLWKLISNMSLNYLSLANVDALKVIL
ETYDLPRYYDQHAAKVSKRLLGGLKAVRHEHVDRLHRGLPLRGLRTELTIDPEGYIGEGDLFVFASVLNE
FFALYASINSYHELRVRSTQGDVYQWKPRMGLQPLL
 
Nucleotide Sequence: 1581 bp     [Download]
>gi|110645304|ref|NC_002516.2|:1808193-1809773 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGATGCACCTGCTGTGGCCGAACTATATGCGCCCGCTGCCGGCTTTCAGCATTCTCCAGTTCGACCCCC
TGACCCGCCCGGGCGGGGCGCTGCGCGTGGAGCGCGATACGCCGGTCGAGAGCCGGCCGGTGGGCGAGGT
CGCCTGTCGCTTCCGTACCTGCTACGCCACCGAAGTCCTGCCGCTGGTGCTGGAGGCGCTCAACTATTCG
GTGACCGGCGAGGGTGCGCTGCTCGGCCTGCGCCTGGCGATGAACTGCGACGGGCATCTCGGCGAGCTGG
GCCTGAGTCGGCTGCGCCTGCACCTGGCCGGCGAGCGCTACATCAGCCAGATGCTCTACCTGTGCCTGCT
GCGCAACCTGGAGAGCATCCAGCTGATTCCGCTGGACGCCCATGGGCGGCCGCTGGATGGCGTGGCCGGC
AAGCCGATGTCGTTCCGCCTGACGGGCGAGCGGGTGCAGCCGGTGGGGTTCGCCGAAGACGAGGCGTTGA
TTCCCTATCCGCTGAATACCTTCCGTGGCTATCGCTACCTGCAGGAATACTTCGCGTTCCAGGACAAGTT
CCTGTTCGTCGACGTGGATGGCCTTGACCTGCTCGGCGCGCTGCCCGAGGAAACCCTCAAGCAGGTCCGC
GGCCTCGAGTTGCGCTTCGATATCCGCAAGAGCGGCATCCAGCGCCTGCACCCGACGCTGGAGAACGTCA
AGCTGTACTGTACGCCGGTGGCCAACCTGTTCCGCCACGATGCGCTGCCGATCCGCCTCGACGGCAAGCA
GGACGAGTACCTGCTGATGCCGGCCGAATACAGCCTGGAGGACTGCGGGGTGTTCTCGGTAGAGGGCGTC
ACCGGCTGGCGGCCGGGCGGGCTCGGCTACCAGGCCTATGTGCCGTTCGAGTCCTTCGAGCACGATCCCA
GCTTCGACGTCCCGGAAGCACGGCCCCACTACAGCGTCCGGCAACGGACCTCGTTGCTGCACGATGGCCT
GGACACCTACCTGAGCTTCGGCATCCGCCATCCCGAGCAGATCGAGACGCTGTCGGTGGAACTGACCTGC
ACCAACCAGAACCTGCCCCAACGGCTGCGCCTGGGCGATATCTGCGTCGCTTGCGAAGGTACGCCGGAGT
TCCTCGGTTTCCGCAATATCACCCCGGCGACGCCGAGCTACGCGCCGCCGCTGAACCGCGATTTCCTCTG
GAAACTGATCAGCAACATGTCGCTCAACTACCTGTCGCTGGCCAACGTCGACGCACTCAAGGTGATCCTC
GAAACCTACGACCTGCCGCGCTACTACGACCAGCATGCGGCGAAGGTCAGCAAGCGCCTGCTGGGCGGGC
TCAAGGCGGTCCGCCACGAGCATGTCGACCGCCTGCATCGGGGCCTGCCGCTGCGCGGCTTGCGTACCGA
GCTGACGATCGATCCGGAAGGCTACATCGGCGAGGGCGACCTGTTCGTGTTCGCTTCGGTTCTGAACGAA
TTTTTCGCGCTTTACGCCAGCATCAACTCCTACCACGAGTTGCGGGTGAGGAGCACACAGGGAGACGTGT
ACCAATGGAAACCGCGCATGGGTTTGCAGCCCCTGCTGTAA